Conserved Protein Domain Family
MFS_3

?
pfam05977: MFS_3 
Transmembrane secretion effector
This is a family of transport proteins. Members of this family include a protein responsible for the secretion of the ferric chelator, enterobactin, and a protein involved in antibiotic resistance.
Statistics
?
PSSM-Id: 399164
Aligned: 6 rows
Threshold Bit Score: 649.503
Threshold Setting Gi: 81622290
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9I0E1     6 ASPWSPLRQTTFRWLWLASIASNIGTWMHEVGAGWLMTSLSASPLNVALVQVAGSLPMFFLALPAGALADIVDKRRYLLG 85  Pseudomonas aeruginosa
Q92LE2    11 STALAPLRNGVFRSIWTASQISSLGWLVQTVAISWLMASISASDLMVALVQAASTLPVFFLSILAGAIADNFSRRWVMFA 90  Sinorhizobium meliloti
Q92SW7    14 ISPLAPFRHDIFRTIWIASLASNFGGLIQAVGAAWLMTSISQSVNMVALVQASTSLPIMLFSLVSGALADNFDRRRIMLV 93  Sinorhizobium meliloti
Q9HYE1    25 TGTWAPFSIQAFRIIWICNLFANLGTWAQSVAAAWVVTDAHASPLMVAMIQVAAALPLVLLSILSGVIADNHDRRKIMLW 104 Pseudomonas aeruginosa
Q92Y88     8 TSGFAPLRQKVFAVLWIATIVGNTGSFIRDVASSWLVTDLSAAPAAVAMVQAAATLPIFLLAIPAGVLSDILDRRKFLIV 87  Sinorhizobium meliloti
AAK89442   8 ASSFAPLAQPVFAVLWAATVLGNTGSFMRDVASSWLMTDLSASPAAVALVQAAGTLPIFLLAIPAGVLTDILDRRKFLIA 87  Agrobacterium fabru...
Q9I0E1    86 VQLWMALVATLLASLTLLQLTSVWLLLGLTLCMGIGTALMMPAWSATTPELVGKDELPAAVALSSVGVNLARAVGPAIAG 165 Pseudomonas aeruginosa
Q92LE2    91 GHCLLALASTTLVISVGIGFISPWLILGLGFLAGCGFALNDPAWHASIGDILHKRDIPAAVTLTSVGYNIVRSGGPALGG 170 Sinorhizobium meliloti
Q92SW7    94 AQSFMLAVSALLTVCAYYGIVTPWLLLIFTFLLGCGTALNNPSWQASVGDMVPRDDLPAAVALNSMGFNLTRSVGPAIGG 173 Sinorhizobium meliloti
Q9HYE1   105 GLSFEMTGAMFATLLAFLGYLDPVLLIISILWISLGGSVTIPAWQAAVNEQVPARMVSDAVLLNSVNYNVARAAGPALGG 184 Pseudomonas aeruginosa
Q92Y88    88 IQLLLAAASICLMLLSATGLQSVSSLIALTFVGGIGAALMAPTWQAIVPELVARQDVKSAVALNSLGINISRSIGPAVGG 167 Sinorhizobium meliloti
AAK89442  88 VQLLLASVSVTLMVLAHTGMLSVSALIGLTFLGGIGAALMGPTWQAIVPELVKREDIKSAVALNSLGINIARSIGPAVGG 167 Agrobacterium fabru...
Q9I0E1   166 VLVSLVGPWLTFALNALSFFAVIAVLLAWKREAVPSVLPAERLFGALRAGWRYSRSSRPLQSVLVRAVAFFLGASAGMSL 245 Pseudomonas aeruginosa
Q92LE2   171 VILAFFGPLTAFALAALCDLTPLGAIWRTKWHVRASPLPREKITTAIYDGLRFTAMSFEIRSAVARATLFGLASISILAL 250 Sinorhizobium meliloti
Q92SW7   174 AIVAAAGAAAAFAANTLSYFAILFALARWKPVAPENRLPRETLGRAVSAGLRYVAMSPNIGKVLVRGFAFGLSASAILAL 253 Sinorhizobium meliloti
Q9HYE1   185 LLLSAVGPAWVFLFNSFCYMALIWAIWQWRRDVPKRSLPPEGILEGVTAALRFTQYSTVTRLVMMRSFAFGLSASAVWAL 264 Pseudomonas aeruginosa
Q92Y88   168 LLLAWFGAAFTYGVDVISYVFVIVALTWWRRAATPDDVLSERFFGAFRAGLRFAKASRELHVVLLRAAVFFAFASAVWAL 247 Sinorhizobium meliloti
AAK89442 168 ILLAAFGAAFTYGADVASYFFVIAALLWWPRAKNANNALQENFFGAFRAGLRYTRASRPLHVVLLRAAIFFAFASAVWAL 247 Agrobacterium fabru...
Q9I0E1   246 LPLIVRGELHGNAMDFGLLLGSVGVGAVLGAAFLPRLRERLGSDRLVLLSSVLYALVLVALALLRNLYLLVPVMLLSGAA 325 Pseudomonas aeruginosa
Q92LE2   251 LPIVVRDQLASGPIVYGILLAGFGSGAFVAGMSNSFLRRIMSQNKLVAVASVACAACCLSLALTSSVAVAAFALALGGAG 330 Sinorhizobium meliloti
Q92SW7   254 LPLVARDLVGGGPLTYGVMLGAFGVGAIGGALLSARLREFLTSEAIVRYAFAGFAFSALVTAISPQAWLTCLVLAVSGAC 333 Sinorhizobium meliloti
Q9HYE1   265 LPLLAHRNPDGDAAIYGYMLGALGLGAILGSTQVSRLRQRIGSSRLISLAGFTLALILLTLGLVDNLWVLFPVLILGGGC 344 Pseudomonas aeruginosa
Q92Y88   248 LPLVARDLLDGDAGFYGILLGAVGAGAIGGALILPRLRTRFDADALLLGAAVVTAAVMAILSVAPPRWGAIVALLALGAA 327 Sinorhizobium meliloti
AAK89442 248 LPLVARQLLGGDASFYGILLGAVGAGAIAGALVMPKLRARFDADGLLLGAAIVTALVMAGLSFAPPKWLAIIILLFLGGA 327 Agrobacterium fabru...
Q9I0E1   326 WIAVLSSLQVAAQTSVPAWVRARALAVYILVFFGSMAAGGALWGLVASHLSITFALLCASAALLLGLFASLRCRLPVTEA 405 Pseudomonas aeruginosa
Q92LE2   331 WLITWTGIDVSVQLASPRWVVGRTLSIYYALSAGGMAAGSWVWGTVAQNHSLTWALEGAAAALLLVAAAGILFPVRPWEE 410 Sinorhizobium meliloti
Q92SW7   334 WVLALSLFNTTVQLSTPRWVVGRALSLYQTMTFGGIAGGSWLWGVTAEQYGAANALIGSCLLMLAGAAIGLRFALPEFKS 413 Sinorhizobium meliloti
Q9HYE1   345 WIGALATYNSAVQILVPDWIKARALALYQTALYGGLALGSFLWGHLAETMTVHGALLAAGCLLLASVILLYNSRLPEMDA 424 Pseudomonas aeruginosa
Q92Y88   328 WITALTTLNGAAQAILPNWVRGRSLAVYLTVFNGAMTAGSLAWGAVAEALNIPLTLNISAIGLAAAGLLFHFVKLPKGES 407 Sinorhizobium meliloti
AAK89442 328 WITALTTLNGAAQAILPNWVRGRGLAVYLTVFNGAMTAGSIGWGAVGEAAGVPGTLLIGAAGLFIAGLIMHRLKLPAGDA 407 Agrobacterium fabru...
Q9I0E1   406 EDLAPSLh--WPAPLVDEEVDQERGPVMVTLEYDIDPQDAAAFQAAMVEVRAMRRRNGAVSWGLVQDSGNRRLWLEFFID 483 Pseudomonas aeruginosa
Q92LE2   411 ADQESSD---FHPPELALALKPRSGPIGVKIEYSILEENIEAFLGCMRARRHVQSRAGARNWTLQRNLQTPSVWIETFRT 487 Sinorhizobium meliloti
Q92SW7   414 LNLDPLNr--FNEPLLELDLKPRSGPIVVMIDYEIADEDIPEFLKTMAERRRIRIRDGAGHWALMRDLENPTTWTETYHV 491 Sinorhizobium meliloti
Q9HYE1   425 -ASISRApasMPGQP-SFVFNTRRGMVLVSIEYRIPAERTRDFVRAAQPLRRLRLRNGAERWSLFRDVSNPEVWQELFLV 502 Pseudomonas aeruginosa
Q92Y88   408 -DLIASNh--WPEPLVAALVDNDRGPVLILIEYKVDKTERPDFLKALAKLSNERRRDGAYGWGVTEDAADPERIVEWFMV 484 Sinorhizobium meliloti
AAK89442 408 -DMVPSNh--WPEPLVAEPVAHDRGPVLILIEYTVEKDHRSAFLHALDELSQERRRDGAYGWGVTEDSADPQKIVEWFMV 484 Agrobacterium fabru...
Q9I0E1   484 ESWLEHLRHHQRVTRGELRVEAAARRFQSAGVEVRIRHYLhgaARP 529 Pseudomonas aeruginosa
Q92LE2   488 PTWMDFLRLNHRLTAADKEVVEHLQALHDGKLPPQTVLSI---ERT 530 Sinorhizobium meliloti
Q92SW7   492 PTWVEYVRHNQRRTQADAAVGDKLTAFHRGPNPPRVHRMI---ERQ 534 Sinorhizobium meliloti
Q9HYE1   503 DNWIQHLRMLDRMTLADKIVIDNVTALHAGDGPPQIRHCVsyeASS 548 Pseudomonas aeruginosa
Q92Y88   485 ESWAEHLRQHRRVSKADADVQQEVRRFHKGAEAPVVSHLLs-iNRP 529 Sinorhizobium meliloti
AAK89442 485 ESWAEHLRQHKRVSNADADLQGKVLAYHSGLEKPVVRHFLt-iNRP 529 Agrobacterium fabrum str. C58
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap