Conserved Protein Domain Family
Peptidase_M15_2

?
pfam05951: Peptidase_M15_2 
Bacterial protein of unknown function (DUF882)
This family consists of a series of hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399149
Aligned: 8 rows
Threshold Bit Score: 258.095
Threshold Setting Gi: 81637264
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2YIP2  25 ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQVYQSTGSREY-ITVVSAY 103 Brucella abortus 2308
Q8EF76  33 STKGVRELSLFNRHTGEYNNGSYWVDGHYQSEVLADFSHLLRDHRQNVAAPMDKRLFDLLYTLKSTLNTDKE-IHVISGY 111 Shewanella oneidensis
Q92JX1   7 AAGQTRTLKLYFIHTKEKAQITYKRNGRYDQKGLQQINRFLRDWRRNEPTKMDPRLLDLVWEVYQKSGSRDY-IHVVSAY 85  Sinorhizobium meliloti
Q7CT90  62 AAAETRSLKLYYIHTREKAVITFKRNGKYDQKGLQELNRFLRDWRRNQPTRMDPRLFDLVWEVYRRSGATDY-INVVSAF 140 Agrobacterium fabrum ...
Q9A852  64 PAVDPRWVHLHNVHTGEKLEAVYWENGDYVPDAVSALDKVLRDYRNDEVHPIDRGLYDLLDQIARKTQSKGP-FQVISGY 142 Caulobacter vibrioides
Q9CNZ9  33 STPKPRILRFRNINTGEKFSAEFLPSKGFSSVALKKLDYLMRDKRNNHMHRMDPKLFLKFYRLQASLGLRNTeIQIICGY 112 Pasteurella multocida
Q9KSI7  30 YAAKPRELALSNLHTGESIETRYFNGKNYVRSELKRLNHLCRDFRRDEVHAMDKLLFDQLCQIQLLLGTQAE-VHIVSGY 108 Vibrio cholerae
Q7MJP7  37 YPDQPRTLALNNLHTGELLETCYFDGSTYLIEELARIDKICRDFRQNEVHPMDRRLFDHLTQIQKLIGTENE-VQIISGY 115 Vibrio vulnificus YJ016
Q2YIP2 104 RSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGspFVHMDVGNVRHW 176 Brucella abortus 2308
Q8EF76 112 RSPKTNAMLAGKSGGVAKKSYHMQGMAMDIAIPGVNLKTIRDAALSLKLGGVGYYPKSG--FVHVDCGPVRHW 182 Shewanella oneidensis
Q92JX1  86 RSPATNGMLRSRSKGVAKKSQHMLGKAMDFYIPDVKLKTLREVGMKFQVGGVGYYPTSGspFVHMDVGGVRAW 158 Sinorhizobium meliloti
Q7CT90 141 RSPETNGLLRTRTKGVAEKSQHMLGKAMDFYIPGVKLATLREIGMQMQIGGVGFYPTSGspFVHMDVGGVRAW 213 Agrobacterium fabrum str. C58
Q9A852 143 RSPATNRLLSKRSGEVAKKSLHMDGKAMDIFLEDVELKHVRAAALDLSVGGVGYYPTSN--FVHVDVGPVRKW 213 Caulobacter vibrioides
Q9CNZ9 113 RSPVSNAAMHRRSRGVASNSYHTRGQAIDFRIDGVPLAKLRQAAEKLNNGGVGYYPRSN--FIHVDTGPVRTW 183 Pasteurella multocida
Q9KSI7 109 RSPATNKQLRSKSKGVAKKSYHMSGQAIDFRLDGVSLKKIREAAISLQAGGVGYYPKs--qFIHIDTGPVRQW 179 Vibrio cholerae
Q7MJP7 116 RSPQTNAALRAKSSGVAKKSYHMLGRAIDFRLDGVKLSTVRDAALSLEAGGVGYYPGSN--FVHIDTGPVRSW 186 Vibrio vulnificus YJ016
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap