Conserved Protein Domain Family
EB1_binding

?
pfam05937: EB1_binding 
EB-1 Binding Domain
This region, found at the C-terminus of the APC proteins, binds the microtubule-associating protein EB-1. At the C-terminus of the alignment is also a pfam00595 binding domain. A short motif in the middle of the region appears to be found in the APC2 proteins.
Statistics
?
PSSM-Id: 399141
Aligned: 5 rows
Threshold Bit Score: 252.996
Threshold Setting Gi: 512810700
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P25054       2670 RSGRSPTGNTPPVIDSVSEKANPNIKDSKDNQAKQNVGNGSVPMRTVGLENrLNSFIQVDAPDQKGTEIKPGQNNPVPVS 2749 human
XP_015193203 2664 RSGKSPTGNTPPVIDSLPEKLIADDSDANDPQSKQPMVNENAPVRVLGLEN-VNSITKSEYTDKKGMDGKAAASNPGATP 2742 spotted gar
POI31857     2332 RSGRSPTGNTPPVIDSVSEKGVVNGKDSKEIQEKQNPGNGSVPVRTIGLENrLNSFFQMDSPDKKGNETKPLQTNPVPAP 2411 Chinese bambo...
XP_002936457 2668 RSGRSPTGNSPPVIDNVLDQGQKEEA-VKDCHTRHNSGNGNVPL----LENrQKSFIKLDGSDTKGTDPKTLINN---QQ 2739 tropical claw...
XP_014351222 2380 RSGRSPTGNTPPVIDNVPENMIKDEKDSKEMQAK-NAGNSNAPIH-VGLENrLNSFIQIDSPEKKASETKSMVVNPATTP 2457 coelacanth
P25054       2750 ETNESSIVERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSKTDSTESSGTQ 2829 human
XP_015193203 2743 ETHENPISERTPFSSSNSSKHSSPSGAVAARVTPFNYNPSPRKSSNDGTSARPSQIPTPVNSSTKKRDSKGEGVESSGNQ 2822 spotted gar
POI31857     2412 ENNESTVSERTPFSSSSSSKHSSPIGAVAARVTPFNYNPSRRKSSVDNSSARPSQIPTPVNNSTKKRDSKSENTDSSGTQ 2491 Chinese bambo...
XP_002936457 2740 ETNENTVAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSTAESSTSRPSQIPTPVTNSTKKRDSKTETTDSSGSQ 2819 tropical claw...
XP_014351222 2458 ETTENPVVERTPFSSTSSSKHSSPSGAVAARVTPFNYNPSPRKSSTENSSARPSQIPTPVNNSTKKRDSKTESTDSSGNQ 2537 coelacanth
P25054       2830 SPKRHSGSYLVTSV 2843 human
XP_015193203 2823 SPKRLSGSYLVTSV 2836 spotted gar
POI31857     2492 SPKRHSGSYLVTSV 2505 Chinese bamboo-partridge
XP_002936457 2820 SPKRHSGSYLVTSV 2833 tropical clawed frog
XP_014351222 2538 SPKRHSGSYLVTSV 2551 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap