3KXY,3EPU,1XKP,4GF3,6JNP,1K6Z


Conserved Protein Domain Family
CesT

?
pfam05932: CesT 
Click on image for an interactive view with Cn3D
Tir chaperone protein (CesT) family
This family consists of a number of bacterial sequences which are highly similar to the Tir chaperone protein in E. Coli. In many Gram-negative bacteria, a key indicator of pathogenic potential is the possession of a specialized type III secretion system, which is utilized to deliver virulence effector proteins directly into the host cell cytosol. Many of the proteins secreted from such systems require small cytosolic chaperones to maintain the secreted substrates in a secretion-competent state. CesT serves a chaperone function for the enteropathogenic Escherichia coli (EPEC) translocated intimin receptor (Tir) protein, which confers upon EPEC the ability to alter host cell morphology following intimate bacterial attachment. This family also contains several DspF and related sequences from several plant pathogenic bacteria. The "disease-specific" (dsp) region next to the hrp gene cluster of Erwinia amylovora is required for pathogenicity but not for elicitation of the hypersensitive reaction. DspF and AvrF are small (16 kDa and 14 kDa) and acidic with predicted amphipathic alpha helices in their C termini; they resemble chaperones for virulence factors secreted by type III secretion systems of animal pathogens.
Statistics
?
PSSM-Id: 399138
Aligned: 24 rows
Threshold Bit Score: 70.4064
Threshold Setting Gi: 299856740
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3KXY_E   9 RLLAEFAGRIGL--PSLSLDEEGMASLLFd-EQVGVTLLLLAERERLLLEADVVGIDVLGEG-----IFRQLASFN-RHW 79  Pseudomonas aeruginosa
Q7VWI2  17 QLIADFGRLIGI--DSLNPGAGGLCQLIFe-PCAPVFIAPVHARTEIMISCVLGTADAA--------NPASMARANf--M 83  Bordetella pertussis
Q88BP9   7 GLLEHSLKTLGFdtSALQALRDDGYLLWQgkDKQASLLVPSTDGDALFAICTLSRVDPEHDGr----LLALALHLNlSPV 82  Pseudomonas syringae ...
Q87P21   4 KMMKSLAETLGI--GPFIAGENGAYTIEV----DQLTLTIKQHSSWILWETALPLRFNEHLDyqqeqALKRCMQLSlKTL 77  Vibrio parahaemolyticus
1XKP_C   3 NLLXNLAASLGR--XPFVADXQGVYRLTI----DXHLVMLAPHGSELVLRTPIDAPMLREGNnvnvtLLRSLMQQAlAWA 76  Yersinia pestis
Q7N0V2   3 TLLNHLASRLGQ--KPFVSDRQGHYHLHI----DNYNLFFRQQGTELVLSSPLSWRHNPKDPsg-aeLLKTLLQQVtRWG 75  Photorhabdus laumondi...
4GF3_A   6 sLLEEFATELGL--EEIETNELGHGAVTI--DKIWVVHLAPINEKELVAFMRAGILTGQS-------QLYDILRKNlFSP 74  Yersinia pestis
Q7NZE7   9 HCAAELLRHLGFd-APQPAAGQEVVSLTV--EQRFTLHLGAIDQDSWFMQADLGDALPSPSAa----LLERALRGNqIAA 81  Chromobacterium viola...
6JNP_E   7 aAIHQLFLALDL---PTPNDEESVLSLQV---GPHLCHLAEHPTDHLLMFTRLEGQGDA-----------TANEQNlFSQ 69  Pseudomonas aeruginosa
1K6Z_A  11 QAITQLFQQLSL---SIPDTIEPVIGVKV---GEFACHITEHPVGQILXFTLPSLDNND--------EKETLLSHNiFSQ 76  Yersinia pestis
3KXY_E  80 HRFDLHFGFDELTGKVQLYAQILAAQLTLECFEATLANLLDHAEFWQ 126 Pseudomonas aeruginosa
Q7VWI2  84 QAGSGVVACIGGDGLFYLQQAIPLSRATPAILLDHCERLLQEASRWR 130 Bordetella pertussis
Q88BP9  83 HTMSACIALDVEQNTLCLRYTHDLGGNGADTLLLALENAQALAEQIK 129 Pseudomonas syringae pv. tomato
Q87P21  78 RDTPSVLTTN-ADQQLILQGKAMIENTSNDQFAELLAQHANVCERYM 123 Vibrio parahaemolyticus
1XKP_C  77 KRYPQTLVLD-DCGQLVLEARLRLQELDTHGLQEVINXQLALLEHLi 122 Yersinia pestis
Q7N0V2  76 RHAPHALTLD-ESENLILEARLNLDSLDVQILEQMLTLHVDLLEQVM 121 Photorhabdus laumondii subsp. laumondii
4GF3_A  75 LSGVIRCALD-KDDHWLLWSQLNINDTSGTQLASVLTSLVDKAVTLs 120 Yersinia pestis
Q7NZE7  82 RPWQPVAALD-TEGRLGCWLRLPSHGVDLPMLAAALDALIAAAEDLL 127 Chromobacterium violaceum
6JNP_E  70 DPCKPILGRDPESGERLLWNRQPLQLLDRAQIHHQLEQLVAAAEELR 116 Pseudomonas aeruginosa
1K6Z_A  77 DILKPILSWDEVGGHPVLWNRQPLNSLDNNSLYTQLEXLVQGAERLQ 123 Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap