Conserved Protein Domain Family
Phage_GPL

?
pfam05926: Phage_GPL 
Phage head completion protein (GPL)
This family consists of several phage head completion protein (GPL) as well as related bacterial sequences. Members of this family allow the completion of filled heads by rendering newly packaged DNA in the heads resistant to DNase. The protein is thought to bind to DNA filled capsids.
Statistics
?
PSSM-Id: 399135
Aligned: 35 rows
Threshold Bit Score: 131.95
Threshold Setting Gi: 219867823
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014004985     22 VENDGWYIDINLPLMRDAMRLDGTVTDPRLRQAVVAAIMHVNQELADWKRDQIAAGYKTLAAVPA-DHIDR--------E 92  Collimonas f...
P51722           14 ITNNGFWSDIYVEEFQKQRAIPLQIPVEMVKAALVAAIQGVDLDLADVAESYRKSAVNSVTEISS-PLIND--------E 84  Haemophilus ...
utah:Sant_2543   14 LTNDGFWPDLNVSDFQSQRTIPADIDAATVRQALLTAAGEINDDLASVVAQLRSGGHDSAAAVPG-MEIAG--------E 84  Sodalis prae...
WP_012987561     14 LTNDGFWPDLNLKEFQVNRKLPADLDNDMLANALLATVAEINLDLQRLKSRLQAKGYPCAADVLG-ISING--------N 84  Xenorhabdus ...
IEC:ABF-0018453  31 LANNGFWPDLNVRDFQSQRTIPADLAADTVAQALLAAVGEVNADLAEVEARSRAKGFARAQDVPG-VSLKG--------Q 101 Dickeya dada...
WP_014292206     14 VTNDGFWPDIEVGEFERDRAMPADLQPATVAAAVLSAVAQVNLELVFTKTRLLAEGHASAAAVPG-PTVGT--------Q 84  Oceanimonas ...
ACR69433         14 LQNDGFWPDIDAGDFERARTIPPVIDHGVVINALLTAIAELNMSLTATQTRYREAGYNTADAVPGpAAIDAvrrdgaprR 93  Edwardsiella...
jgi:Ddes_0243    19 LDGDGFYPDLAVAEFMELYRLPAEYAEALIADHLDLARLWAAGELAAWREKQQASGHTALDQISV-HGISG--------- 88  Desulfovibri...
jgi:Daes_0451    15 VSNAPWWPSLSVADFQTRYRLPREYAESVLVDGLQIGMIWANMALASWQAKQDAAGHESLSVVPC-VEIGG--------E 85  Pseudodesulf...
Q2SPX1           15 LANDGFFPDLSLAEFQRVYRIPAEYHGDMVAAHVRQAMLDINFSLAMRKAEWLGGGFKTLDAVGA-EQLDG--------H 85  Hahella chej...
WP_014004985     93 SVLIAHYRRAVYSTAKADMIERYRDIDSTASSlsdKKMMEWLDTAPSDQRRNAHWAIANIIGRPHMTVELI 163 Collimonas fungivorans
P51722           85 NYAETLYKKAVFARAKAELLPEFNTLSGREIH---QNR--DYVTEQKSLLAEATHAIRTLKGKKRGSVWLL 150 Haemophilus phage HP1c1
utah:Sant_2543   85 NLLCARYRKAVFARAKADLIGEFASVGRRDSH---PGQ--ESDDTRTSLIAESTLAVRRLKGLKRVTVAMI 150 Sodalis praecaptivus
WP_012987561     85 NALVSQYKKAVYARAKADLLGEYTTLVSRAPN---PGQ--ESPEARNRLLAEASVVLRNMKGLKRATVRLI 150 Xenorhabdus bovienii
IEC:ABF-0018453 102 NVLCAQYQKAVFARAKADLLGEFATIGRRESH---PGQ--EGDDTRKGLLGEAAMVIRRMKGLKRATVRMv 167 Dickeya dadantii 3937
WP_014292206     85 TMLTALYRQAVFARAKADLVTEAGSLSQRDAG---NNQATQSGDVRAALLAESQQHIRAIKGAHRCGIELL 152 Oceanimonas sp. GK1
ACR69433         94 THLTALYIKALYARAKADLLPEFATIGRRDAH---PGQ--EAPDVRRGLLAESAMALRAIMQRPRCSVSLI 159 Edwardsiella ictaluri...
jgi:Ddes_0243    89 -GALRLYKRAVFCRAKALLLPQFATIERREPA---RNDAKEAPESAQAFFAQAANALAAITGRTFISVEAI 155 Desulfovibrio desulfu...
jgi:Daes_0451    86 PSLVISYRRAVMSYAKAYLMQQFPTINRREAA---NNEARESEATEDKFREYASQALAQVLGVPSIAVELI 153 Pseudodesulfovibrio a...
Q2SPX1           86 NVLVLYYLRAVSCRAKASLLNAFATMNRRAQA---ENLAKESDDTEQSLLSDSVRALRRLLGAATGITAEL 153 Hahella chejuensis KC...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap