Conserved Protein Domain Family
API5

?
pfam05918: API5 
Apoptosis inhibitory protein 5 (API5)
This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms. Apoptosis or programmed cell death is a physiological form of cell death that occurs in embryonic development and organ formation. It is characterized by biochemical and morphological changes such as DNA fragmentation and cell volume shrinkage. API5 is an anti apoptosis gene located in human chromosome 11, whose expression prevents the programmed cell death that occurs upon the deprivation of growth factors.
Statistics
?
PSSM-Id: 399130
Aligned: 19 rows
Threshold Bit Score: 557.765
Threshold Setting Gi: 470239786
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002971368  11 IAMLYEYGERLSNSEDK-SKNESDYLGIIEAAKSKGKVKQLAAQLIPRYFKYFPNLSVRSLEAQLDLCEEEELGITVQAV 89  Selaginella moe...
XP_003529359  11 IEKLYEYGEQLNNAKDK-SQNVQDYQGIIDAAKTSVKAKQLAAQLIPRFYKFFPDLSSPALDAHLDLVEAEELGVRVQAI 89  soybean
XP_003385268   6 VEALYRNYGILADAGDKaGEQTEAFLGLLESAKGSAAVKRLVSGFIAKFARFFPTLEGDIMNVLFDLVEDDESLVRQAAI 85  Amphimedon quee...
EKC39907       4 IETMYQNFGVLADAKEKaGEHEEEFLSILNAVKGSPGEKRLASQFITRFFKYFPSHAGTAINAMFDLCEDDDPMTRKQAI 83  Pacific oyster
NP_955834      5 VEELYRNYGILADAKEDlSTHKDAYQVILDGVKGGAKEKRLAAQFIPKFFSSFPELADAAINAQLDLCEDEDVSIRRQAI 84  zebrafish
EFX89475       4 IDKLYQHYEILNEAKDDiAKHRKEYEDILLAVKGSDKEKKLASQFIAKFAKSFPDLENETIDAMFDLCEDDDVLIRKQAI 83  common water flea
XP_015787483   4 IDKMYDNYNILVDAGDKiTEHEDKYLEILNSVKGSPNEKRLASQFITKFFKHFPAHYNSAIDALLDLCEDDDINIRKQAI 83  two-spotted spi...
Q9V431         4 IERLYKCYEILSEAGDKiSEHVDEYKEILKAVKGTSKEKRLASQFIGNFFKHFPDLADTAIDAQFDLCEDDDTQIRRQAI 83  fruit fly
ETN60634       8 IEKLYKNYEILSDAKEKiTEHEAEYREILDAVKGSAKEKRLASQFIGKFFKHFPSLANTALDRQLDLCDDVDPQIRRQAI 87  Anopheles darlingi
Q16MI7         8 IEKLYKNYEILTDAKDKiGEHELEYREILDAVKGSAKEKRLASQFIGKFFKHFPNLAELAIDRQLDLCEDEDAQIRKQAI 87  yellow fever mo...
XP_002971368  90 RGLATICKDSKDL---LPKVADVLGQLLITEEPLEKDAVQKALMSILRQDAKATLTALFKHVENSD-----ENLREKVLA 161 Selaginella moe...
XP_003529359  90 RGLPLFCKDTPEN---IGKMVDILVQILGSEEFVERDAVHKALMSLLRQDVKASLTALFKHIGSVEepstdDVIREKVIN 166 soybean
XP_003385268  86 KSLPELCKNNKSNkdlCTKVADVLTQLLVSDDPADVILVKSAMSTILIHDTPSALIGIFDQILGED-----ETLREKAIE 160 Amphimedon quee...
EKC39907      84 KDLPTLCKSAPEQ---VSKIASALTQLMGTDDATENHLIQSSFLTLFKFDSKGSLDGIFSQILGED-----ETVREKAIK 155 Pacific oyster
NP_955834     85 KELPRFASGEN-----LPRVADILTQLLQTDDSAEFNQVNTALISIFKIDAKGTLGGLFSQILQGE-----DIVRERAIK 154 zebrafish
EFX89475      84 KDLVNICKDNKGA---VRKIAYALAQILQSEDNSEVTAVHNSIASLYQIDPAATIEALFSELAEDN-----EVMRERTLK 155 common water flea
XP_015787483  84 KDLPSICRDCKEY---VPRITDILAQLLLAQDATELQIVNNSLITVCKLDPKGFLGGIFLQIEAGE-----DITRERVIK 155 two-spotted spi...
Q9V431        84 KDLPKLCQGNADA---TIRVGDTLAQLLILDDPTELQQVNNSLLAIIKLDTKSSIAGLFQQISTGD-----ETTRERCLK 155 fruit fly
ETN60634      88 KDLPQLGRESTDH---TPRIADILAQLLGSEDVSELQQVHQSLMTLTKYDALGSLTGIFSQIGTGD-----ETVRDRCFQ 159 Anopheles darlingi
Q16MI7        88 KDLPQLCKDTKEH---TPKIADILAQLLITEDVTELQQVHQSLLTLAKFDATGTLTGIFSQIVSGD-----EPTRYRNFQ 159 yellow fever mo...
XP_002971368 162 FIREKVFPLKNDLLQPQEEMERHVTDLIKKSL-QDVTGAEFKMFMEFLKSLSIFGEKAPQERVQELLEIVESQADLDS-- 238 Selaginella moe...
XP_003529359 167 FVRDKVFPIKAELLKPQEEMERHITDLIKKSL-EDVTGIEFRMFMDFLKSLSLFGEKAPAERMKELIGIIEGQADLDA-- 243 soybean
XP_003385268 161 YVSVPLMDMRHVLFIPKEENEKCLLELVKKVL-GDVTAAEFETFVDVLGKLHH---LQSPEGANVIIDVIAEQAELDG-- 234 Amphimedon quee...
EKC39907     156 FLGAKIKTLPEDTL--DSHSEELLINMCKKVL-EDVTKDEFIAIMEILKCQKS---MTTVQGRQQLVDIVTEQAELDE-- 227 Pacific oyster
NP_955834    155 FLSTKLKTMPEDIM--TKEVEDYIFVETKKVL-EDVTGEEFVLLMRILSGLKS---MQTVSGRQQLVELVVEQAFLEQ-- 226 zebrafish
EFX89475     156 MLAMKLRTLETGVM--KPEVKELLVKECKKIL-QDVTADEFVLVMAILGQCKI---ADSVSGQQQLVDLVAEQCNFTQ-- 227 common water flea
XP_015787483 156 FLAAKIKTLPEDTW--TKEDEEFILAEGRKAL-QDCTKDEFVCLLNLLSSLKI---SKTITAQQVLVDMITEHAELDA-- 227 two-spotted spi...
Q9V431       156 FIATKLLTMGPTVI--TKEIEDYIVEEIKKAL-QDVTADEFHLCMTILGATKL---GSTITGHAELVKLATEQAELNNtd 229 fruit fly
ETN60634     160 FINNKIMKIGPEII--TKPLEDFIIAEIKKALsEDVTADEFHQCMAILGQTKL---SKTLPGHVELVKIAAEQADLDNd- 233 Anopheles darlingi
Q16MI7       160 FILNKLIKIGPEVI--TKEVEDFVIAEIKKIL-LDVSADEFHLCMSILNQTKL---SKTVTGHAELVAIAVEQADMEAd- 232 yellow fever mo...
XP_002971368 239 -QFKVEDTDHIDRLMACLFMSLPFYARGASNSKFLNYINKSLFPAF--DKLPE-----DKKTELLKKIAESVQFSSAQD- 309 Selaginella moe...
XP_003529359 244 -QFNVSDADHIDRLISCLHMALPFVVRGASSNKFLNYINKYIISVF--DQLPG-----ERKVDLLRSLAEFSPYTTPQD- 314 soybean
XP_003385268 235 -NFQSEGPEAIDRFITCFRLALKYCKKGGSSYQFVRYASVEILPSF------AsitdaQKQQNVLQLLAEGSCYVQPENd 307 Amphimedon quee...
EKC39907     228 -PFVASDPDCVDRLTQCIKHAAPLFSKNVHSKAFVGYLCDNVLPHI--DQLASpedgvNGKLELLKLMAEISEFTGELEd 304 Pacific oyster
NP_955834    227 -ALNPADTDSVDRLLQCTRQALPLFSKNVHSTRFVTYFCEFVLPNL--SQLTSpvaelDIQLEVLKLLAEMSPYCGDMDk 303 zebrafish
EFX89475     228 -VFNPADQEHLDRIIICIKHALPYFSTQVKSTAFVSYICDQVLPHR--NEIGQs----EQKLDIFKLLAELSSNCGPLDp 300 common water flea
XP_015787483 228 -PLNPAETEQIEKFTMCVRAAIPHFSPFVPSNAFVQFICSQIIPCMt-EIVSLaienpNIEVEILQQLAELSAFIQPTNt 305 two-spotted spi...
Q9V431       230 aDIIAVDDEVVERFIQCASAAAPYFSKTIKSTAFVAHVCDKLLPIKtwNMIATavsqdQIQLRLLKVFAEMITNTDKLDn 309 fruit fly
ETN60634     234 pGVLASDDETVERFINCATEAMPYFSSQVESTRFVKFVCEKFLQRNvwSLIGAadehhQTQLRLLKVFAEICPSCGTLEk 313 Anopheles darlingi
Q16MI7       233 lGSLASDDETVERFIQCASEAMPYFSSQVESTQFIKFMCEKLLPLNvwNLIGAgedqhTTQLRLLKVFAEMCAFCGSLEk 312 yellow fever mo...
XP_002971368 310 -----ARNLLPTILQLLKKYMPKRK--------------TTEEFNYLHVECLLYAFHQLAHKSPNSTNSLCGYKIVTGQP 370 Selaginella moe...
XP_003529359 315 -----SRQMLPSIVQLLKKYMTWKK--------------TGEEMNFTYVECLLYTFHHLAHKVPNATNSLCGYKIVTGQP 375 soybean
XP_003385268 308 -----VEICLESLHLFLLEHVPSPPeet---------atESPKLQFSVVECLLFAFHQLVNKSPGFLAS----------- 362 Amphimedon quee...
EKC39907     305 -----LEQRLKNLYDCLISYMPLPPeeene----desasGEPKLAFSSVECLMYAFHQLCRKQPSFLAA----------- 364 Pacific oyster
NP_955834    304 -----LEVNLNMLFEKLLEFMPLPPeeeng----enaanEEPKLQFSYVECLLFSFHQLGKKLPDFLID----------- 363 zebrafish
EFX89475     301 -----VVERIQIVYDTLLEYMPLPPpvleetngdgstteTEIRLEFTFVESLIFAFHQLARQHREFLI------------ 363 common water flea
XP_015787483 306 nlpinLDECQEVVFSKLLEYMPSPSlstdv-----eeksEEPSLQLFPLESLMFTLYTLSVINPEF-NS----------- 368 two-spotted spi...
Q9V431       310 -----ASERINAVYNVLLEYMPLPKlsde------dlgdTPPSFQFSHAECLLYALHTLGKNHPNSLSF----------- 367 fruit fly
ETN60634     314 -----ASEKVQAIYEVLLEYMPLPPlda--------dlnETPSFHFSHAECLLYALHTLGKQATEFLTF----------- 369 Anopheles darlingi
Q16MI7       313 -----PAEKVEAIYNVLLEYMPLPPada--------dmnETPSFQFSHAECLLHALHTLGKQAAEFLTF----------- 368 yellow fever mo...
XP_002971368 371 SDRLGEDFTDLYKDFIERqvialLEVAESLSKSTLKKLTQGMTK----VPAAKDENGKAEEkakkvalgVGLRSCNNITK 446 Selaginella moe...
XP_003529359 376 SDRLGEDFSEHYNDFTER-----LNNVEEFTRATIKKLTQGMDEnnksMAGAKTDEEKEKIktkkqnatTGLRTCNNILT 450 soybean
XP_003385268 363 -----PENEERLKELRKR-----LQYFARGSQTYHNQLQVALKGk--tQLELKEEQNKLRQ--------MALKMTANIST 422 Amphimedon quee...
EKC39907     365 -----EENAERLKDFKIR-----LQYFARGVQVYIKHLRMALQGk--tGTELKEEENKMKV--------AALKITSNINT 424 Pacific oyster
NP_955834    364 -----KVSAEKLKDFKIR-----LQYFARGLQVYIRQLRVALQGk--tGDALKTDENKIKV--------VALKITNNINV 423 zebrafish
EFX89475     364 ------DNADRSKDFRSR-----LQYFARGVQGYIKKLRESLQDk--gVDQLRDEEGRIKV--------TALRTTSNINS 422 common water flea
XP_015787483 369 -----KVNEDRMKDYKLR-----LQYLARLIQSHIKKAKEVPSAd--kKVENEGDDALSKA--------IALKTATNINT 428 two-spotted spi...
Q9V431       368 -----VEDAEKLKDFRAR-----LQYLARGTQGYIKKLEESLKGk--tGEELKTEENQLKQ--------TALKTTSNINI 427 fruit fly
ETN60634     370 -----PDNPAKLKDFRSR-----LQYLARGTQGYIKKLQEAVKGk--tVEEMKSEENQIRV--------TALKTTSNIST 429 Anopheles darlingi
Q16MI7       369 -----PEDAAKLKDFRSR-----LQYLARGTQGYIKKLQESVKGk--tMEEMKSEENQIKA--------TALKTTSNIST 428 yellow fever mo...
XP_002971368 447 LITPLKQKTPEFlgGPKNFNPSWKE---AAKPAAAAATatqas-------------apansGAKRPAaa----------- 499 Selaginella moe...
XP_003529359 451 MTKPLHAKVPSFi-GDKRINLSWKE---ATK--AASTApa--------------------aGAKRPAnaa---------- 494 soybean
XP_003385268 423 LIKDFFRNPPTY---NATVQLSWGA---KKIDLGTKRSlatpl-------------pssnpSKRKLSpirfded------ 477 Amphimedon quee...
EKC39907     425 MIKDLFHSPPSF---KSVITLSWKPlv--------------------------------vrIKQKRTpi----------- 458 Pacific oyster
NP_955834    424 LIKDLFHNPPSY---KSTVTLSWKP---VQKTEAAAAi-----------------------GQKRRSgedi--------- 465 zebrafish
EFX89475     423 LIRDLFRNPPSY---KVNVTLSFKP---TNASQAAKQTaavavgne--------stseasgVAKRHApit---------- 478 common water flea
XP_015787483 429 LVKELFHPKPAS---KSSVTLSWKP---TKTKSAAIKRtnstadttvaptatkledattnaSNPKRKpit---------- 492 two-spotted spi...
Q9V431       428 LIRDLFHSPPIF---KHDIVLSWIVpknNk-------------------------------LGKRHApitfgeka----a 469 fruit fly
ETN60634     430 LIRDLFHTPPSF---KSNVQLSWFVpkgKKQQQKEAEEvk--------------------aGNKRHApitfdangkagkg 486 Anopheles darlingi
Q16MI7       429 LIRDLFHTPPSF---KSVIHLSWLPpksKAVVDAKt-------------------------TAKRHAaitfee------- 473 yellow fever mo...
XP_002971368 500 -----nNGATTKRARGEQhqHQQrqpeqqhLVNKAFAG-ISRGGGGGgGGRRQWR-------AGRGRGR 555 Selaginella moellendorffii
XP_003529359 495 ---ngsNNIASKKGRGAGglQNQ-------LVNRALEG-L-SGGGRG-GMRGRGRg-----wGGRGRGR 545 soybean
XP_003385268 478 kssggaSGGAAKQRGGRReaRAIynpprrqPVTNGNSF-DEGSWKTGgGGGGRGGrr----gGWRS-GR 540 Amphimedon queenslandica
EKC39907     459 ----tfETNGAGGKKPHKqdRSIyhppsgkFSEKAGT--FESNETRSqGQRGRGGgggyrrgGWRGRGR 521 Pacific oyster
NP_955834    466 --gataTTKKHPTNLPRRdaRQIynppsgkYSASIGN--------FSyEQRGGFR-------GGRGRGF 517 zebrafish
EFX89475     479 ----feSSPPKVRVNTDNrvRQPyvvptgkFSANVSA--------HGaDSRPRGRg------GYRG-GR 528 common water flea
XP_015787483 493 ---apeDSESSD---SKKrqRQLyappsgkFSYNFRG--------GYsNNRGRGRgt----gGFRGANR 543 two-spotted spider mite
Q9V431       470 angkdkDQEPEKKSRPSNd-qKFysppsgkYSNKVNQ-------SYGnNNRTRQRgg----gGGGGSGG 526 fruit fly
ETN60634     487 aatgggDTKGPKQSKPGPgsQKMytppsgkYSGKIHN--NQQSKNGGsGRRGSVGgn----gGGGGGGG 549 Anopheles darlingi
Q16MI7       474 -ngkphDSKGPKHAKSSSgtQKVytppsgkYSGKVQNYsTKNGSGGGsSNGGRRSgg----gGGSGGGG 537 yellow fever mosquito
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap