Conserved Protein Domain Family
RIB43A

?
pfam05914: RIB43A 
RIB43A
This family consists of several RIB43A-like eukaryotic proteins. Ciliary and flagellar microtubules contain a specialized set of protofilaments, termed ribbons, that are composed of tubulin and several associated proteins. RIB43A was first characterized in the unicellular biflagellate, Chlamydomonas reinhardtii although highly related sequences are present in several higher eukaryotes including humans. The function of this protein is unknown although the structure of RIB43A and its association with the specialized protofilament ribbons and with basal bodies is relevant to the proposed role of ribbons in forming and stabilizing doublet and triplet microtubules and in organising their three-dimensional structure. Human RIB43A homologs could represent a structural requirement in centriole replication in dividing cells.
Statistics
?
PSSM-Id: 399127
Aligned: 60 rows
Threshold Bit Score: 221.693
Threshold Setting Gi: 220978138
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006096263   4 YSLP--PDPKEVAATEARRNRELERQKRFLDVRTRTMGVDVGTLNSQVEERKLREIRERCKEEAYGTAQVHYDMVAQMLE 81  little brown bat
EGF81576       4 VEIL--GDTLHNAAIQRRQRLDEERKQRIFNPKVRILGIDLQALDEQIQIKNELKEIDKQRNDALDKSSKLNNDILQLMD 81  Batrachochytriu...
EFC46225       1 mfpftdvETKERLAIEKRRQAEEERRKRILDPKARTMGLDVAGIQSQIEEKEQIKKREQDRDRYFDQASLVHAKVANIME 80  Naegleria gruberi
EED96464       1 mllqqglqDQEEQRLFALRQRLEDRSKRFVNAKARTIGVDKDALDKQVEEKRQQQLAEREEKLADAQRIQALVTCLDQKE 80  Thalassiosira p...
XP_002907125   6 mpppsapEDKEELRVEARRQREIERYKKLGPGRLRSIGANIVGVKNQIEERERQNEADRDAKRVSEEEDAAIRRYLLQVE 85  Phytophthora in...
Q9VTP5         7 ICTK--QDLDEAMKLQKREQYEDERKRRIFNAKQRLYGLDLEMLDRQILEKKKQRTAQMECDKKFEEQEQLQKRLILAQE 84  fruit fly
XP_001843158   4 qlftkhQDLKETAAIERRRQSEEARRARIFNARQRVIGIDTTALEQQLQEKHEQLQAEQERKRKFAEEQRRQNQVVNRKQ 83  southern house ...
XP_002429413   3 psLK--VDEKEACRLQRKKENLEKIKARLLNPRLKENGADVETWKRQQEEKKRLKEEEQRKELEYQRQKLKEDLICVITD 80  human body louse
XP_021203168   4 LQIAneQDRKEAQNRERRRQCELERRNRIFNARNRKIGVDVPFLERQVQEKRSEREEQQRRELAFAQQMIKDSNLAAVLE 83  domestic silkworm
XP_321351      6 fVNH--QDQKEALAIERRRRFEESRKQRIFNARRRIIGVDTDALGLQVQQKHEAEQAQAEQQRKFAEEMRRQEQVLLLKQ 83  Anopheles gambi...
XP_006096263  82 KEDA-ERTRRLAKKVQEFREQKQQLKNKREFNLWGPDQLWKGFQALC--ANN-DAH-YGPSSLQCFAGEDPGRAATIRMQ 156 little brown bat
EGF81576      82 EQVQ-KARRHCLQQTNQYRRDHQQPHQRRDYDLYDPKALQKDVSTRVtnGQSkDHP-IGISSLQRFEGEDLAAEKRTMLQ 159 Batrachochytriu...
EFC46225      81 KEMH-QTKKQVYKEVNDFRKNEQLPHTRREFDLNDPDELKKSRPIRV--GDY-DPS-LTISGGQIMHGEDLGREERLKAQ 155 Naegleria gruberi
EED96464      81 AAEQ-EAKKLSLGELKRTLDAQARQPKNNALRMDDPINVDR----------------CGPSSLQRLSGEDRSYEIRKKEQ 143 Thalassiosira p...
XP_002907125  86 SEDAlSKRREVLTLRNDWDLQTAKIQQARAEFAAT-------RAVSI------DPDtCAQGAAQKFDGEDLARLERIRLQ 152 Phytophthora in...
Q9VTP5        85 MELE-KKQRVVDSDLNYYRCRYQRKEQRREFDLNDPNFLKKARPTRV--ADN-DIS-LGVSSAQIFQGEDLYNSDRKQRQ 159 fruit fly
XP_001843158  84 HEQQ-QLRHLLNSEENRFRRLYQRPEQSRDFDLFDPDGLKKALPARV--GDD-DPR-LSVSGAQKFDGEDLTERERRRLQ 158 southern house ...
XP_002429413  81 KKIQ-DEKKEILKKVQEFRQNYQSFESRREYDLNDPHYKKKALPIRI--SDD-DPR-CTISSVQKFEGEDLRRIERLRIQ 155 human body louse
XP_021203168  84 ARQR-EERRRIGLEIDKYRQNYQRTEDRREFDLNDPDVLKKQLPPRA--SDG-DP--VGMSSAQKFEGEDLNYEERKKLM 157 domestic silkworm
XP_321351     84 HEQR-QDRVREENELNRFRASHQKPEQSRDFDLFDPDGLKKSLPARL--GDD-DPR-LTISGAQKFDGEDLEERHRRKVQ 158 Anopheles gambi...
XP_006096263 157 QEQLKHNLDKQIQERQQARADERRTN-ELREKLRIAVETRAVQLAKLEESCRIAMKYAMANAHKAQAAEVAERRLQEYRR 235 little brown bat
EGF81576     160 KDQMRVWANEQVFEKERRRQEELD-EkKRYEEFQKSIGDKMAALQSSVEQAQREQARLDSEYNQSLAAEKRLREQQQKEY 238 Batrachochytriu...
EFC46225     156 QDQLKCWVSEQVNEKQMVKEKEDL-ErKLFEQKELEIQRLTYELREKENMIKLEKERERKEFNVEQWNDKEEKEKLQREK 234 Naegleria gruberi
EED96464     144 QEQVQFWCAKDTLEKKRALEEERR-ReQEYAEYVLEQDRIRAELEAAAKKRRDEENRRTQFENVELARRAREMKMQESKA 222 Thalassiosira p...
XP_002907125 153 AMQMKQWSIQKMAEDAQRNAHENA-DmAAYMAQLFEIERLMEELHRGNERDRAAAAAEISRFNQRLLALQRQDESDRRRL 231 Phytophthora in...
Q9VTP5       160 REQQRAWLDQQVQERKRAEDARKQAD-NVLMDNVGCRDKHLQEMAKSDHQMRNQVIQRVRQFNINMAKQKQLDREREKRE 238 fruit fly
XP_001843158 159 MQQQRSWLEQQIRAKRQAEQDRIAGE-RFLEEALEAREQRVHQLASEERYAKQKVKESVDNFNRQLMNQQEYERRQKKQQ 237 southern house ...
XP_002429413 156 GEQTRAWLEQQIAEKRQDEQEKEKAE-QVYMEALVARDKRSVQLAKLEEECIRKLQQSTAEYNKILANEKEIRERNRRLK 234 human body louse
XP_021203168 158 AAQKNAWLEQQVQERKGAEEERKKAE-AAYMMAIKARDLRASELDKLERECRYRLGQANLRYNEALAAEKKQIEQIMKEQ 236 domestic silkworm
XP_321351    159 IEQQRSWLEQQIREKRQAELDRRAAE-TFLESSLMSREHRLHQLASQERYARGKIQQAVNEFNRRLMNEQEQQRLRRERE 237 Anopheles gambi...
XP_006096263 236 EQEANLKDIHTQIKSDLVNEKPQITPQPVMANpasRILPYggKGKGVIPEKQTSIKKAQAAQWREKEVQRRAEQARDAEW 315 little brown bat
EGF81576     239 DNNLNTYEIVSHINSTFLTEASGTSASRQSS----KMRAD--LFKGITTEQRKEILDTQERQRMEQQKRLDEKIKEEERW 312 Batrachochytriu...
EFC46225     235 EELDKLEEIQNQLNSHLLNEAFHTTLNVNDPN---RFRPD--HFKHMRPDQYEHIEQVRQEQLRELQQKRDTESLNQQYW 309 Naegleria gruberi
EED96464     223 EKLAQAEQSHYLQTCPLLTEDKSLTMNVNAPDh--RFRPD--HFKGYQQDKVIEMYKENDTVVEEKRDLLIGEAQTEADW 298 Thalassiosira p...
XP_002907125 232 EQEENAREIQLTLESHLVSENPLQA-TLPGVSldhRVRVD--HWKGFSGEQTKYFLRQNDDIMAENARRRQQEREQAEGE 308 Phytophthora in...
Q9VTP5       239 KYEDDMAEIYNMLSSDMLTENPDVAQSRTDPN---KKIAF--MYRGMTPEELRVFRLGQDQQLRLSIQRKTEAQMMDKQW 313 fruit fly
XP_001843158 238 EEEDNRAEIYNHLSSDILTENPEVAKSALGPN---RIIPY--SYKGMGPEELEQIRNGQLEQQQEMRRLRQAEANNKEAW 312 southern house ...
XP_002429413 235 DDLDKEAEKVNWINSDLLTENPEVAASSLGPH---RMIGY--LYKGGGPGKAKEIAKFLEMQKEEKKRRQSEEAIINKEW 309 human body louse
XP_021203168 237 EEADNTAEMYNNLTSDMLTENPDVAKSALGQN---RAIGF--MYKGMNQEELKKFYAGQKEQMEAAKVKREAEQKMEAEW 311 domestic silkworm
XP_321351    238 EQEDNLAEIYNNLTSDVLTENPDAAKSSFGPN---RVITA--QYKGMSPEEIEQVRRTQDRQLEELKRRREQEANTRKAW 312 Anopheles gambi...
XP_006096263 316 GRQAACLAQASMELEEQERQLCAEFR-RGLGSFNQQLAYDHKAQQNYLNSVIYTGQAAVPHNLQFNTSGR 384 little brown bat
EGF81576     313 AIQETMNNRALNLLERERVRNSREKA-IQIRRENEAKAIEDKKRRTYIDKVLYTNAPQDAYFMQFNTTSR 381 Batrachochytrium dendroba...
EFC46225     310 DKKRLLETKMAGLQLREQERAKKQQA-AELLELHKRQAEEKKQKEKFVNQ-VYANEVTEDFFNRFGTSSR 377 Naegleria gruberi
EED96464     299 AKRHMEMIQQMAEVEDQKQRRIAEESrRQREILDVQKAELDVRRKELEKARLH--EISSEFFSRFGQCr- 365 Thalassiosira pseudonana ...
XP_002907125 309 SRAQREIQRTLAHEEFLTQQRRAQME-MDVRATQQRQAKLATEREKS-NDDRARGKIDPSFFQRFGRTYR 376 Phytophthora infestans T30-4
Q9VTP5       314 EQYSINMDRTLVLHQIEDDRRRKAEF-DELMRANSKLAVEQDRQRKE-ALVGLTNAVSDDFYDQFNKNSR 381 fruit fly
XP_001843158 313 DRLANQFDQTVVMKDRELNRRRRELA-GRVGFENLQLSDEQRRKLEFMDRQLYQNRPTMEYFNQFNTTSR 381 southern house mosquito
XP_002429413 310 DALAKKMDRQILNKDKELMKQQRMLN-AEMFEINKKLAFEKQEREEYMKK-ICTNIPTEEYYNKFNSSly 377 human body louse
XP_021203168 312 QALSKSIQREVAVQDIEDKRKRREMA-RQLMEENQLMALQQKEREKYFREVVYNNTPTDDYYSQFNTTTR 380 domestic silkworm
XP_321351    313 DQLANEFDRTVTLKERELNRRRHALA-EQIRHENRELSMEQQRRVEYLDRVVYQNRPTEAYFDQFNTCTR 381 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap