Conserved Protein Domain Family
FPP

?
pfam05911: FPP 
Filament-like plant protein, long coiled-coil
FPP is a family of long coiled-coil plant proteins that are filament-like. It interacts with the nuclear envelope-associated protein, MAF1, the WPP family pfam13943.
Statistics
?
PSSM-Id: 399124
Aligned: 28 rows
Threshold Bit Score: 740.722
Threshold Setting Gi: 514804327
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KRH04564       64 KDELVKKQTKFAQEAMAGLKKADAEVLSMKQDLDEALQQRLVYEERVAHLDGALKECMQQLRFVREEQGQRIHDAVMKAS 143  soybean
XP_004977037   46 KDAILAKQAKVAEEAILGWEKAEAEALLLKTQLDDTLDDKTAIEQRICQLDEALNVAM-------VERDSLIKETAQMIS 118  foxtail millet
XP_002518728   63 KDDLVLKQENSVQEENTGQEKMEMQVVSLKKELDEAIKQGVAANEKLTISEAALKQCMQQLRSVHQEEEQRRHDAFMKAS 142  castor bean
XP_002282435   63 KDDLVTKYARMAEEAIAGREKAEAEALSLKQELDEALNLGVAAKERLSHLDAALKQCMQQLTSLKEEQEQRIRDAVMKTL 142  wine grape
XP_010652793   65 KDDLVKKHAKTAQEAITGWERAKAEVVTLKQELDEALRQRVAGEERLTHLDAALKECMQQLRFVREEQEQRIHDAVMKTA 144  wine grape
XP_006339871   63 KDDFAQKQMKIAQEAIAGWEKTETEARLLKQELEKALQQSIAGEERLVNLDAALKECMQQLRFIRDEQENRIHDAVSNAS 142  potato
XP_003538808   64 KDEQIKKQTKIVQEAVAGWEKAEAEILSMKQHIDESIQQQLVYKERVAQLDGALKECMQQLRFVREEQEQRIHDAVMKAS 143  soybean
XP_009417187   46 KDDLLAGQAKVAEEAIAGWQKAEAEALSLKQQLDDALLQKKTAEERVVNRDIALKQCMQQLHAVKEEQQFIITNAALKIS 125  wild Malaysia...
XP_009413342   46 KDDLLAKQAKVAEEAIAGWRKAEAEALSIKQQLDDTILQKKAAEERAADADMALKECKQQLHAVKEDQQFIISNAALKIS 125  wild Malaysia...
XP_009418797   46 KDDLLAKQAKVTEEAIAGWEKAEAQALYLKQQLDDALFQKKSAEERVIETDVALKECMQQLRVVKQDQQLFINNAAFKIS 125  wild Malaysia...
KRH04564      144 KEFERERIVLEEQLSETSKRLAKAEVENSHLNKSIFARENLIEDLKSQLTQAEADHSALMNRLESTENDNTSLKYEVRVL 223  soybean
XP_004977037  119 CEQDKVQK-LEESLVEKINIIANLDAENDKLSEIVSVKENMISELIESKGLTESNLKDLARKLESAERTNSSLRYEVCML 197  foxtail millet
XP_002518728  143 RESEKAQKQLEEKLREMSKRLADLAIENTNLSKALVLKEKLVEELHKHASQTAAEFNALMARLDSTEKENAFLKYEFHML 222  castor bean
XP_002282435  143 REFEKTQKNLEDNLTETSKRLTDLTVENTHLSKALLAKEKLIEDLCKIKSQADTEFKALMARLDSTEKENAFLKYEFRML 222  wine grape
XP_010652793  145 REFEKTQMVLEEKLAETSKRLAKLGAENTHLSKALLAKEKLIGDLSDRRKQTEADFNALMTRLDSTEKDHASLKYEVRVL 224  wine grape
XP_006339871  143 KEFEKTRFLLEKKLADAGQKLSRLGSENTQLSMALMAKEKATGHLKGEIDRAEADFSALMTRLESVEKDNASLRYEVRVL 222  potato
XP_003538808  144 KEFEEARIVLEEQLSETSKGLAKSGVESSRLNKSIIAKENLIEDLKRQLAHAEADHNALMIRLESIEKDNASLKYEAQVL 223  soybean
XP_009417187  126 REQEKTRT-SEQKLVETNKRLADLVLENGNLNRILDVKEQLLKELSESKSKSEANFTDVKSRVDSSEKLNDSLKYELCML 204  wild Malaysia...
XP_009413342  126 REQEKSRT-LEQRLVETNKRLTEAVVENGNLNRVLEVKEKLLKELSESNSMSEAKFTEVKSRLDSSEKLNASMKYELCML 204  wild Malaysia...
XP_009418797  126 REQEKIGM-LEQRLIGTNKRLTEFVIENGNLNRIIEVKEQLLKELSESISKSESKLTEVITRLDSSEKFNASLKYEVCIL 204  wild Malaysia...
KRH04564      224 EKELEIRNEEREFNRRTADVSHKQHLESIKKIAKLESECQRLRLLVRKRLPGPAALAKMKNEVDMLGRDSFEIRRSKLSS 303  soybean
XP_004977037  198 QKQLEIRSEERKFSLKSADAAHKQHLENVKKITKLESECQRLRSMVRKRLPGPAAIAKMRSEVETVGSDTTTTRMRKLNS 277  foxtail millet
XP_002518728  223 EKELEVRSEELEYTRRSAEVSHRQHLESIRKITKLEAECQRLQILVRKKLPGPAALAKMKNELEMLGRDSLESRRKA--N 300  castor bean
XP_002282435  223 EKELEIRNEEREFNRRSAEAIHKQHLESVKKIAKLEAECQRLRLLVRKRLPGPAAVAKMKSEVETLGRDQTEMRRKKLNP 302  wine grape
XP_010652793  225 EKELEIRNEEREFNRRTADASHKQHLESVKKIAKLESECQRLRLLVRKRLPGPAALAKMKNEVEMLGRDPSEMRRRKSSS 304  wine grape
XP_006339871  223 EKELEIRNEEREFNRRTADVAHKQHLESVKKIAQLDSECQRLRILVRKRLPGPAALAKMKTEVEMLGKDHAKMRIRKSNP 302  potato
XP_003538808  224 EKELAIRNEEREFNRRAADASHKQHLQSVKKIANLESECQRLRILVRKRLPSQASLAKMKNEVEMLEHDSLEMRRKNLNS 303  soybean
XP_009417187  205 QKELEIRSEEREFNHRSSNAAHRQHLESVKKIAKLETECQRLRVMVSKRLPGPTALAKMKSEVEMLGNNSVETRKKKSTS 284  wild Malaysia...
XP_009413342  205 QKELEIRNQEREFNHRSSNAAHRQHLESVKKIAKLETECQRLRVMVRKRLPGPTALAKMRSEVEMLGNNSTELRKKRSSS 284  wild Malaysia...
XP_009418797  205 QKEIEIRNEEREFNRRSADAAHRQHLESIKKIAKLETECQKLRVMVRKRLPGPAALAKMRNEVEILSEYAIETRKKR--- 281  wild Malaysia...
KRH04564      304 TSSV----VESSVDTSPETPIRRINTLTEKLCAMEEENKTLKESLDRKMNELQFSRVMLS-------------------- 359  soybean
XP_004977037  278 AASQns---cVSVQNSHDALHGNSPLLA-RLHAIEDENKAIKESLSRKDGELQFSRTMLA-------------------- 333  foxtail millet
XP_002518728  301 LTRDlvlrD-TPLEKSPVIPIKNINFLIEQLQDTEEENKTLKDILTKKNAELRSARIMYS-------------------- 359  castor bean
XP_002282435  303 MTGGliarD-GLVEKSSEIPSKKMSFLIERLCEVEEENKTLKEILAKKNNELHSPRLLCA-------------------- 361  wine grape
XP_010652793  305 SPTGlm-vD-SVAYNSLDTPSKSTNFLTEQLCSMEEENKTLKEALVKKANELQFSRIMYA-------------------- 362  wine grape
XP_006339871  303 SPNGs--vD-LTSETAPDTPNRNINFLSEQLCMLEEENRTLKEALNKRANELILSRMTNA-------------------- 359  potato
XP_003538808  304 TSVV----VESSLDSSPETTIRRITALTDQLCTVEEENKTLKESLNRKTNEVQFSRVMLA-------------------- 359  soybean
XP_009417187  285 TNEAfnikD-NIFEGSHNASNKSGASLVERLRSIEYENKILKESLTKKNSELQASHIMLA-------------------- 343  wild Malaysia...
XP_009413342  285 TSEAfnikD-IIREDSYDASGKGAASLVERLHAIEDENKILKESLTKKNSELQASRVMFTrttsklsqaetkleelskgq 363  wild Malaysia...
XP_009418797  282 --------TEIGLENFYDTSSKDMTSLVVRLRAIQDENKILKESLTKKNNELQASRIMFA-------------------- 333  wild Malaysia...
KRH04564      360 -----RTASKLLQLESQTEESSKAlvtVEQP-RSYLtSHEFSLASMSDAGS-DDKASCAESWASaliSELEHFRSGKEKE 432  soybean
XP_004977037  334 -----RTTSKLSQVEAQLEELSRGragAELV-KGSPtVVENPLSSISENGCnEDNVSCSGSWASallSELEHFKKGKP-T 406  foxtail millet
XP_002518728  360 -----HTASKLSQVESQLVVISKGqkaMDMVnSASPlSKELYPLSGFDTGS-DDGVSSSGSWANpitSELEHFRDAKLKS 433  castor bean
XP_002282435  362 -----RTPSRFGQPEAQLGESPKSqktMDLV-SCSPiSNGHSLPSGFDIGS-DDGISSSGSWANaliSELEQFRHAKPKN 434  wine grape
XP_010652793  363 -----RTTSKLSQDEVQLEESPNGhvlLEPT-RTSLaSHDLSLASMSDVGS-DDKVSCAESWASsliSELEHFKNGKHNR 435  wine grape
XP_006339871  360 -----QTTAELE--------------------KYLPsAQELSVTSLSDMGS-DDIGGCSESWASalmSELEHFKNEKQIG 413  potato
XP_003538808  360 -----RTASKLMRLESEIE--SRGhvnMELP-KSNPaLQDISLSSMSDIGS-DDKVSCADSWASaliSELEHFRSVKQKE 430  soybean
XP_009417187  344 -----RTTSKLSQVEKKFEELSKGhacIELA-RSSPaTYDLPLSSISEHGGnEDDISCGEPWAYtliSELEHFKGGKP-T 416  wild Malaysia...
XP_009413342  364 acfelA--------------------------RGSPaSYDLPLSSISEHGGnEDTISCAESWASaliSELEHFKSGKA-T 416  wild Malaysia...
XP_009418797  334 -----RTASKLSQVETQLEELSKGqacFELA-KSSPvSHDLPLSSISENGGnEDNVSCAESWASaliSELEHFKCGKL-T 406  wild Malaysia...
KRH04564      433 PLSCKSVGASDIDLMDDFVEMEKLAVVSVEKATEISSASLKAISEINGFsgietkettpevegkeiipvsdhistatnet 512  soybean
XP_004977037  407 AHSSKSTALSDMSFMDDFAEIEKLASGCNDKPLEpyvskkevte------------------------------------ 450  foxtail millet
XP_002518728  434 LPECKSIEVSDISLMDDFVEMEKLALVSAQAPSGGCNHHLsagkelvpvvqs---------------------------- 485  castor bean
XP_002282435  435 PSECKTI-VSDMSLMDDFVEMEKLAIVSADTHFQGSHVPSNTRNASANTlekesggflsdstgkelv------------- 500  wine grape
XP_010652793  436 TPSRKTVRVSDINLMDDFVEMEKLAIVSVNKPLGNLHPSSQEADTAIGTmdkesasseskgreivp-------------- 501  wine grape
XP_006339871  414 PPSSISVGASDINLMDDFAEMEKLAVESTVNPLGAVHHALPRENGNEDAlesqlcshsseaeste--------------- 478  potato
XP_003538808  431 SMSCKSVGPSDISLMDDFLEMEKLAVVSVEKAPKISCASLEENNEIDGLpearpngisseviskeii------------- 497  soybean
XP_009417187  417 TSSCKSAGISELSLMDDFIEMEKLAVVSADKYLEsslstlesslstlgdcnscvttkesctg-----------------p 479  wild Malaysia...
XP_009413342  417 GSSCQSAVVSELSLMDDFVEMEKLAVGSVDKHFEgslgtledsnscvttkeswtg------------------------- 471  wild Malaysia...
XP_009418797  407 SPSCKSVGISELSLMDDFVEMEKLAVITVDKHFEssfstlrdnnecvatkesctepdls--------------------- 465  wild Malaysia...
KRH04564      513 tsevvgmeiipvsdqisdlsksnkktcSIDIFTGNIPGWLQDVVKMVLEQnHVTNKSSDDILDDIRVAL----------- 581  soybean
XP_004977037      --------------------------------------------------------------------------------      foxtail millet
XP_002518728  486 ----------------hfdcsdkqeihSKDIATDKSFDWLQEVLNTIFKQqRISKRSLIELLEDIKIAL----------- 538  castor bean
XP_002282435  501 ----------pvaqdyssstdtkwetqSKDGSIGKSRDWLQDVLKVMLEQnCVSKRSLHELLDDIKIAL----------- 559  wine grape
XP_010652793  502 -----------vsgsqsafsfsnqeiqSENILIGKVPGWLQDILKVILEQiHVSQRNPDEIIEDIRVAM----------- 559  wine grape
XP_006339871  479 ------------rvpvtdryvssndnqSKAILTDKASGEVDNILKMLLEHgHVTERNPYEILEDIRTAL----------- 535  potato
XP_003538808  498 ----------pvsdhlsefstsnqescSIDILNGDIPGWLLDVVKAILEQnCVTHKNFDDICEDIRLAL----------- 556  soybean
XP_009417187  480 dlseatgkelvpikdlshcseennenqVRYVSFESQPSWLQDILRVIIQKhHITQKSLNAILDDVRVAL----------- 548  wild Malaysia...
XP_009413342  472 -------vdlseatgkeftpirsndnqLRYVSLENHPSWLQDILRVIIQKhHIMQKSWSAILDDLRVALgdsnqakhllq 544  wild Malaysia...
XP_009418797  466 ---eetdkelvaikdlshfgetnnetqVKELSLENYPIWLQDILRVILKKhHIMQKSLNAILDDVRAALgdwdgsiepky 542  wild Malaysia...
KRH04564      582 ------------RYVNNPDlCDF-DSSKGSGHIDTQDppqcIHCISCSKnslvvnps--gdennadISPIKRIESQSQED 646  soybean
XP_004977037  451 ---------------------------------------------------------ssgkelvpvdVSAGTTDQIHQPK 473  foxtail millet
XP_002518728  539 ------------GYVNHPSaLEA-DTTAISRHPVESDi---RSYITWKSpnissvvesvneassvdTLKEETSKQHSQSN 602  castor bean
XP_002282435  560 ------------GFVNDPSvVEA-DKAASSRHLGEPDsqpiSGYITWKSmefpmags-lhkgsvidTSVEGASHQQNQSD 625  wine grape
XP_010652793  560 ------------AHINHLNtGDFfDARKSADHPDGSIlsppSGYISPKTpnvssvmgssdrvtgvdNSSSETSNQKLQSD 627  wine grape
XP_006339871  536 ------------A-----------QKFPSSKNPAEANesviDTDVTCSPnngdckei--htgagdnVSSERKGEPDMLSF 590  potato
XP_003538808  557 ------------SYLNNADqCRF---DSSKGHPFDGSkplhFSQLTSWKplnnsvvdpcgevndaeILSIKGTKQKSQRD 621  soybean
XP_009417187  549 ------------GVWNYSTeAKHkDSLYCSDN------------------------------------------------ 568  wild Malaysia...
XP_009413342  545 qpkhtssdsfdgAIsa-------------------------------------------------gIPNRESGTQLCQSN 575  wild Malaysia...
XP_009418797  543 sntl----------------------------------------------------------------------hcndkl 552  wild Malaysia...
KRH04564      647 LSKSIGKIIEIVERISLPAVD---------------------------------------------------YDSSDPld 675  soybean
XP_004977037  474 IEKAVLKLIELIEGVIQKSSK---------------------------------------------------DCSKTVvl 502  foxtail millet
XP_002518728  603 MSKSICKIIQLIEGIDPTPLV---------------------------------------------------CNSAKVdv 631  castor bean
XP_002282435  626 LSKSICKIIELIKSFNLTSLT---------------------------------------------------NSNAPNeg 654  wine grape
XP_010652793  628 LSKSICKMVELIEGISLPSLD---------------------------------------------------YDTEETfs 656  wine grape
XP_006339871  591 MGISINKVIDIIEGINIPSTD---------------------------------------------------DSIPEIls 619  potato
XP_003538808  622 LSQSIGKIIELIEGISMPAED---------------------------------------------------YDNSDSly 650  soybean
XP_009417187  569 -------LLQQPKHISSYLIDgaintgmlnaksgsqlrqsnleksvcklielvegiiqrnikskngqhvlsgDnestfth 641  wild Malaysia...
XP_009413342  576 LEKSICKLIDLIEGIIQRNIKgnngqhvpsgdd----------------------------egtsmhhsvtaAngyva-- 625  wild Malaysia...
XP_009418797  553 pqqpkntssDTFDGAISTHLV---------------------------------------------------Nsknsiql 581  wild Malaysia...
KRH04564      676 kgdgdiisyknv----------------------------gmptgymvrvfqwKTSELSNVLRKFLHVCYDLLSGKTDYE 727  soybean
XP_004977037  503 sggeenngqe-------------------------------mlsgyvaraflwNISELTSVLQNFVFVCNELLYGSTDVE 551  foxtail millet
XP_002518728  632 skgkeslsplg------------------------------aradyfvhvfqwRSFELKNVLERFLHTCSAMLNGKVDPE 681  castor bean
XP_002282435  655 segdkssspckn---------------------------sptpadylvhvfrwKSSELSSVLFQLINICNDLLSEKAYLE 707  wine grape
XP_010652793  657 rkdgsffphkns----------------------------etptgyvvrvfqwKTSELRSVLNQFVHSCDDLLNGKADLE 708  wine grape
XP_006339871  620 hngngllpfesa----------------------------sketaymvrvfqwKSSELSAVLQEFVQTCRDLLNGKVRIE 671  potato
XP_003538808  651 krdgnirahknq----------------------------giptdymvrvfqwKTSELSNVLQQFLHVCYDLLNDKADHE 702  soybean
XP_009417187  642 tksas-------------------------------------angyvaraflwESSELNVVLQNFVTVCSHMLNGKFDLQ 684  wild Malaysia...
XP_009413342  626 ------------------------------------------------raflwRSSELTVVLQSFVAVCNDVLNGKVDLR 657  wild Malaysia...
XP_009418797  582 cqsvlekpvlklielvegiiqrnikskngrhglsidnegaslanryiaraflwEGSELTTILENFVAVCNDLLHGKVDLQ 661  wild Malaysia...
KRH04564      728 NFAKELTTALDWIMNHCFSLQD--------------------------------VSSMKDAIKKQFDWDETRSEGETeNE 775  soybean
XP_004977037  552 SFVHDLQLTLDWIINHCFSLRD--------------------------------VSDMKEAIMKHLELNNs--------- 590  foxtail millet
XP_002518728  682 SFAEEVSCALDWILNNCISPKD--------------------------------SSSKRDKIKRHFSQNESQSESEAgGY 729  castor bean
XP_002282435  708 NFVGELAFTLHWIMSNCITLQD--------------------------------GSSMRDEIKRHFGWGASQSESEPeVG 755  wine grape
XP_010652793  709 KFARELTSALDWIMNHCFSLQD--------------------------------VSSMKDAIKKQFDWDESRSENEVeIG 756  wine grape
XP_006339871  672 KFTEKLTRTLEWIVNHCFSLQD--------------------------------VSSMKDTIKSHFDWG-------MeTG 712  potato
XP_003538808  703 KFATELTTSLNWIMNHCFSLQD--------------------------------VSSMRDAIKKQFDLDETLSENEAeTG 750  soybean
XP_009417187  685 QFTSQVTSTLDWIINHCFSLQD--------------------------------VSDMKETIRKQFDADESYRVNELkAV 732  wild Malaysia...
XP_009413342  658 QFVAQVTSSVDWIISHCFSLQD--------------------------------DSEMKETIRKHLDGDVSYSIEELqAM 705  wild Malaysia...
XP_009418797  662 QFTAEVTSTLDWIINHCFSLQDvsdmketvrkhmnadssysndnelkaltyttkDIDKLDT------------------- 722  wild Malaysia...
KRH04564      776 I--------SHFAEedklhLLRGSLSTLPQVTTlDGHDlqngeiy---ykekeelTNKEKLISAESQKEVLEGkiqs--- 841  soybean
XP_004977037  591 ----------------------------------DGLEivavtghtgihtsdeprTAENAQTSILSDSCCINMgskddvs 636  foxtail millet
XP_002518728  730 Lnh---------------pQVEEKSLCLPIIASsDDQKicnlq--------denkRLNDKL-------KNMECrlqs--- 776  castor bean
XP_002282435  756 Veg--------------dhESKRQSYGWPLGAYsNDQNvfeiekiq-snlqeenrGLKDELRKIESAKKDLEAklqs--- 817  wine grape
XP_010652793  757 Ts-------SQFSEvnnlcLPREHLSCLPAGRApNSHNdffqteevlsnmreenqRLKDELMDMESGKKNLGRrfrp--- 826  wine grape
XP_006339871  713 Vi-------NPIFEfdklqTERGNPLYSPVSTSlARMSylpekevl-psvdnesqLPKDEFPEEGATKVDLEGklea--- 781  potato
XP_003538808  751 M----------FADadklhLPIEQLSCLPVLTNsDCHDvptkdmqy--vdkeeikNIEDEVISSESEKEG---------- 808  soybean
XP_009417187  733 IypakkvgkRDAYEesnitAERKR----PLLSAsNGLNnlsriddieskvkdenehlky----enmsmelrrkdleeklk 804  wild Malaysia...
XP_009413342  706 Vcpakeldklkah----eessiteqrkrPLLSAsNGLyilsrtddieskpkdegerlkfdimsMESRRKDLEEklki--- 778  wild Malaysia...
XP_009418797  723 ------------HEessisEERNIPS-----SStNALYilsrmediesklrdeneRLKHEIMGMESIKNDLEVmlkt--- 782  wild Malaysia...
KRH04564      842 -atdRIKSLMNQLQESEKIIDSLRLEIQSYKESNGKLENEIRNQQVIISNLEEHHT--EEELKEACNKVLALEVELEKKN 918  soybean
XP_004977037  637 tqktSNEVAVSKFQGIEEKASHLRAELNELKESGKITAH-VDGKSTMNE-CSTRESifTSGLNKGKQE------------ 702  foxtail millet
XP_002518728  777 -atdEIETLKMQYPESEQSIKSLQLELETTKESKRMLEDQIEHQNSINEDLDTQLTvaKAKLNEVLQQFSALEVELEEKC 855  castor bean
XP_002282435  818 -atdNSQALMNQLEKSEQSIGSLRTELETLKDSKGLIEDQIENQKLINEELNTQLTvaKAKINEVLQKFSALEVEFEDKS 896  wine grape
XP_010652793  827 -aidQSESLMVQLQESEKTIASLKKELEMLKESKRMIEDQSEHHKFMNEDLDTQLTvsRAELNEALQKLSSLEVELESRN 905  wine grape
XP_006339871  782 -etlRSDSLMVQLQESEKTIKGLEKEVENLRQSKGMIEDQIEKEKMVKEDLEMQFEaaKLELNEACRKACCLEKELEDQN 860  potato
XP_003538808  809 ----RLQSAINQLQESEKTIGSLRLELQTLKELNRMLEEQVQNHAFINADLDTQLT--ETELKEANHKVLALEVEVENKN 882  soybean
XP_009417187  805 tfsdKNETLVAQLRKSEKNSANLQIELAALRESKGQIEDQIINQKLINEDLGTQLTvaKAELNEArqkfstleveleeks 884  wild Malaysia...
XP_009413342  779 -ssdKNEKLVAQLQESEEKISNLRLELAALKESKGKIEDQIINQKLINEDLGTQLTvaKSELNEAHQKFSSLEVELEEKS 857  wild Malaysia...
XP_009418797  783 -ssaKNEELIAQIHESEESISNLQAELARLKESKVKIEDQIISQNLTNEDLETQLTvsKAELNEVRQKFSALEVELEQKS 861  wild Malaysia...
KRH04564      919 SNCKELEAKCTELQVQLESMS-KECSn-NDINEKDKALCNDWEITAASEKLAECQETILNLGKQLKAMAvPKDAS 991  soybean
XP_004977037  703 ------GISCPESKHQLECCSaKEGSk-NVADNEEKHLQMQLEISTASEKLIECRETILNLGKQLKALAsPKDAI 770  foxtail millet
XP_002518728  856 NCCEELEATCLELQLQLESVAkKDSLn-YSVNQEGPQHQNGSEITAASLKLAECQETILNLGKQLKALAtPREAA 929  castor bean
XP_002282435  897 NSCQELEATCLELQLQLESFPeKEVSe-ADQDQEGKQLQTGWEITAASVKLAECQETILNLGKQLKALAsPRDRA 970  wine grape
XP_010652793  906 NCCEDLEATCLELQLQLDRITkKETPn-HDMDQEENQLRTDWEITAASEKLAECQETILNLGKQLKALAsPIEAS 979  wine grape
XP_006339871  861 KSYKKLDSACHMLQLQKESTEkMELSenAEVDPEEKLLQSDWEITAASEKLAECQETILNLGKQLKALAsPGDAA 935  potato
XP_003538808  883 QYCEELETRCIELQLQLESMTkKWSd--NDAYQKDEPLQTDWEITAASEKLAECQETILNLGKQLKALAaPKDAS 955  soybean
XP_009417187  885 ncceelEATCLELQLQLESASsKETPk-YIMRQEEKKIQAECDIVAASEKLTACQETILNLGKQLKALAsPRDAP 958  wild Malaysian banana
XP_009413342  858 NCYEELEAACLELQLQLESAShKETPk-YIMGQEEKQIQAECDIVAASQKLAACQETIQNLGKQLKALAsPKDAP 931  wild Malaysian banana
XP_009418797  862 NCCEELEATCLELQLQLESASsKETS--KDMRPEEKKIQAECDIVAASEKLAACQETILNLGKQLKALAsPKDAS 934  wild Malaysian banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap