Conserved Protein Domain Family

pfam05906: DUF865 
Herpesvirus-7 repeat of unknown function (DUF865)
This family consists of a series of 12 repeats of 35 amino acids in length which are found exclusively in Herpesvirus-7. The function of this family is unknown.
PSSM-Id: 114618
View PSSM: pfam05906
Aligned: 2 rows
Threshold Bit Score: 57.513
Threshold Setting Gi: 81939278
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q69517  36 MGSHPFRQERPQPHNPLTFKPVKTTGTAVVFSAGF 70  Human betaherpesvirus 7
Q69517 386 MGSHPFRQETPRPHNPLTFKPVKTTGTAVDFSAGF 420 Human betaherpesvirus 7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap