Conserved Protein Domain Family
Podovirus_Gp16

?
pfam05894: Podovirus_Gp16 
Podovirus DNA encapsidation protein (Gp16)
This family consists of several DNA encapsidation protein (Gp16) sequences from the phi-29-like viruses. Gene product 16 catalyzes the in vivo and in vitro genome-encapsidation reaction.
Statistics
?
PSSM-Id: 399114
Aligned: 2 rows
Threshold Bit Score: 645.49
Threshold Setting Gi: 137944
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P11014      1 MDKSLFYNPQKMLSYDRILNFVIGARGIGKSYAMKVYPINRFIKYGEQFIYVRRYKPELAKVSNYFNDVAQEFPDHELVV 80   Bacillus virus phi29
KNC25440 2224 MDKSLYYNPNELLSKNRIMNFVIGARGIGKTYGFKKYVINRFLKTGKQFIYLRRYKSELAKVANFFNSLKHEFEGVDFKV 2303 Australian sheep ...
P11014     81 KGRRFYIDGKLAGWAIPLSVWQSEKSNAYPNVSTIVFDEFIREKDNSNYIPNEVSALLNLMDTVFRNRERVRCICLSNAV 160  Bacillus virus phi29
KNC25440 2304 KGRMFFINDKLAGWAIPLSSWQAEKSTDYPDVETILFDEFIREKDNSRYLPDEVKALLNFMDTVIRIREGSRLIGMSNSV 2383 Australian sheep ...
P11014    161 SVVNPYFLFFNLVPDVNKRFNVYDDALIEIPDSLDFSSERRKTRFGRLIDGTEYGEMSLDNQFIGDSQVFIEKRSKDSKF 240  Bacillus virus phi29
KNC25440 2384 SIVNPYFLYFSLVPNISKRFNLYESIAVEIPPSADFVEERKKTSFGKLIEGTDYAKMAMDNQFIGDNYTFVEKRSKESDF 2463 Australian sheep ...
P11014    241 VFSIVYNGFTLGVWVDVNQglMYIDTAHDPSTKNVYTLTTDDLNENMMLITNYKNNYHLRKLASAFMNGYLRFDNQVIRN 320  Bacillus virus phi29
KNC25440 2464 VFAVKYGNKTMGIWVDGYN--MYVSEAYDPYTKHLFVIRKEDMTDNSKLVRSSRHEYRMGKLLSAFEKGMLRFDNLECRS 2541 Australian sheep ...
P11014    321 IAYelfrKMRI 331  Bacillus virus phi29
KNC25440 2542 VDH----KQTV 2548 Australian sheep blowfly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap