2CLY


Conserved Protein Domain Family
Mt_ATP-synt_D

?
pfam05873: Mt_ATP-synt_D 
Click on image for an interactive view with Cn3D
ATP synthase D chain, mitochondrial (ATP5H)
This family consists of several ATP synthase D chain, mitochondrial (ATP5H) proteins. Subunit d has no extensive hydrophobic sequences, and is not apparently related to any subunit described in the simpler ATP synthases in bacteria and chloroplasts.
Statistics
?
PSSM-Id: 399107
Aligned: 45 rows
Threshold Bit Score: 148.913
Threshold Setting Gi: 74962416
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2CLY_B                2 GRKLALKTIDWVAFGEIIPRNQKAVANSLKSWNETLTSRLATLPEKPPAIDWAYYKANVAKA--GLVDDFEKKFNAL--K 77  cattle
XP_015788321          3 AKRITKAATDWAKIQALTGEYKQQSFKKLKAASDNYLRKVQEFPEAPPAIDWNVMKATISNK--AIVDKLEASYKAAlsK 80  two-spot...
ESN92660              3 GRRISKSLIDWAAFAERVPPHQMDYFRAFKSKSDLFVSKVHRYPENIPKIDFAFYKSRIANT--ALVTEFERAYSAV--S 78  Helobdel...
EEN62104              3 GRRAAVKAIDWIAFAERVPPNQKAQFTALKARSDAIYSKYLSTPEKPAAINFAFYKSRLANP--ALVDEFEQKFNAV--K 78  Florida ...
XP_002126529          3 ARQSVIKAVEWGKILERTRPDMKSTIGAFKAKSDGIFNNYVKSKDVKLDIDWAYYQSAVANK--ALVADFEKQFKAY--K 78  vase tun...
1_pfamImport          1 SRQAVIKAIEWGKILERTRPDMKSTISAFKGKSDNIFNNYVKAKELNLDIDWEHYRSAVANK--SLVTDFEKQYKAF--Q 76 
XP_003389325          3 GRKIGQKVVDWAKITDVVSAETKVPILALKGRFEARQARLNSYPDHLQPIDWSHYKDAIKKP--GLVDDFQKQYSAL--K 78  Amphimed...
6_pfamImport          1 GKKFVPPIISYLDLFKRCPKDQVKHLKAMHNKHREYLKRVEKLPPRLPEIKWEDYKDNVREEdlCIVCEFEDRYRSLdaS 80 
WGS:AAPP:GF11261-PA  16 AKNERCQMSNLAEMLKQVPPDQLVQYHMFAKKQDEYKARVRKYPESLPEINWEYYEQNVRVEmvDWVKSYKVKYDKL--H 93  Drosophi...
Q17763                5 AKRVATSSVNWSKLAERLVPEHAAELTRVKGVSGTFQSAVSQLPADLPKIDFAALKKALPAHs-AVLDSLQKQYESV--K 81  Caenorha...
2CLY_B               78 VPIPE-----DKYT--AQVDAEEKEDVKSCAEFLTQSKTRIQEYEKELEKMRNIIPFDQMTIEDLNEVFPETKL----DK 146 cattle
XP_015788321         81 IPYPE-----DTLA--SSIDKMEKESIESAKEMIAFYEERNDECRQMIAKFEKMWPIEWHTLETFAMTFPDWAQw--yGN 151 two-spot...
ESN92660             79 VPFPK-----DKNNlrAVVDEEEKEAMAESKKLIENAQKTISESKDLLAKIDSVPHLEEMTVDLHAYYFPDDA-----HN 148 Helobdel...
EEN62104             79 IPEPV-----DTYT--AGLEEAQKKAQADVKSFVAESNARIKGYEEQAAVYKSLPPTELMTYDDVFAAFPEMKP----DK 147 Florida ...
XP_002126529         79 VPKPI-----DTKS--KELEDKTAKDNEAVKKFLQETEENLTEVMMTVDRLNSLPPFEQMTIDDIFENFPQVKP----DY 147 vase tun...
1_pfamImport         77 VPKPV-----DTKS--KVLEEKSVKDAEAVKKFLADTEDNLAEVMMTVDRLNSLPPFEQMTLDDIFEQFPQVKP----DH 145
XP_003389325         79 VPYPP-----DTFS--EELTKKLERIEKRSLEAIKNAKETSEQLTKELEAIKAQKPLEEMTVDEYLADKPELKKkideDT 151 Amphimed...
6_pfamImport         81 IPFPL-----DPYS--EKIDCMKKEYKNEVHYFNKASEAAIQVIEKEKKRIADMVDFEDMTLEEFRDNWPDKAI----DP 149
WGS:AAPP:GF11261-PA  94 TLFENrhamiDSYRyfEAIDKQTEEVTKDIAQYKAKSNERIAKLQEELDFMKAMKPYDQMTMEEFCCARPHLAP----DF 169 Drosophi...
Q17763               82 IPYGE-----VPAEylKEVDQWVDYNNARIKLHEVKVADGLQEAKKVEEKWAKAPPVEHFDRQHFVEYFPAHFY----DL 152 Caenorha...
2CLY_B              147 KKyP-YWPH 154 cattle
XP_015788321        152 SGrAiYPPT 160 two-spotted spider mite
ESN92660            149 PEkPaFWPF 157 Helobdella robusta
EEN62104            148 EKyP-IWPH 155 Florida lancelet
XP_002126529        148 KKiP-HWPH 155 vase tunicate
1_pfamImport        146 VKyP-SWPH 153
XP_003389325        152 YNyNwYLPk 160 Amphimedon queenslandica
6_pfamImport        150 IKkPtFWPH 158
WGS:AAPP:GF11261-PA 170 INkPtFWPH 178 Drosophila ananassae
Q17763              153 RYqNrI-PD 160 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap