Conserved Protein Domain Family
Rotavirus_VP7

?
pfam05868: Rotavirus_VP7 
Rotavirus major outer capsid protein VP7
This family consists of several Rotavirus major outer capsid protein VP7 sequences. The rotavirus capsid is composed of three concentric protein layers. Proteins VP4 and VP7 comprise the outer layer. VP4 forms spikes and is the viral attachment protein. VP7 is a glycoprotein and the major constituent of the outer protein layer.
Statistics
?
PSSM-Id: 114586
View PSSM: pfam05868
Aligned: 3 rows
Threshold Bit Score: 424.296
Threshold Setting Gi: 401409
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P18570   1 MASLLLLVLAAAVTAQLNIVPSTHPEVCVLYADDHQADankFNGNFTQIFHSYNSITLSFMSYSSSSYDVIDIISKYDLS 80  Human rotavirus B
P30889   2 TTMLLLLVVAALANGQLTILPHEESQICFLQPDNPGFD---FDGNFTNIFRDYASVKISSFTYKAQDADIVEILNVDRDR 78  IDIR agent
P87518   1 MPLPLLLVFAACAKAQLVITPISNPEICVLHASDW--NvnsFGDNFTNIFETYNSVTLSFYQYDSTNYEVIDIISKRDYS 78  Bovine group B rotavirus
P18570  81 SCNILAIDVFNASMDFNVFLQSTNNCSKYNANKVHHVKLPRGEEWFSYSKNLKFCPLSDSLIGMYCDTQLSDTYFEISTG 160 Human rotavirus B
P30889  79 SCTILAIYIADSTLDFNTFLQSENECVKYAASKKHYIKLPRDREYFALAKNLSFCPLNDDLIGIYCDTQLETTYFSVARS 158 IDIR agent
P87518  79 LCHILAIDVVKPEMDFITFLQSNNECTKYAGQKIHYQKLSTNEEWFVYSKNLSLSPLSDSLIGLYCDTEINGTYFPLSEN 158 Bovine group B rotavirus
P18570 161 GTYEVTDIPEFTQMGYTFHSSEEFYLCHRISSEAWLNYHLFYRDYDVSGVISKQVNWGNVWSGFKTFAQVLYKILDLFFN 240 Human rotavirus B
P30889 159 SNYDVTDIPEFTELGYVFHSNDHFYICERKSEGNWIDYQLFYQNDAPLGTVSQRVNWGNVWSNVKTVAQMVYKILDIFFG 238 IDIR agent
P87518 159 EKYDVTDLPEFTEMGYVFYSNDDFYICKRINDHKWVNYHLFYREYSASGTVSRAISWDNVWTGFKTFAQVVYKILDIFFN 238 Bovine group B rotavirus
P18570 241 sKRNVEPRA 249 Human rotavirus B
P30889 239 -KRNIEPRA 246 IDIR agent
P87518 239 nRRNFEPRA 247 Bovine group B rotavirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap