Conserved Protein Domain Family
Lentivirus_VIF

?
pfam05851: Lentivirus_VIF 
Lentivirus virion infectivity factor (VIF)
This family consists of several feline specific Lentivirus virion infectivity factor (VIF) proteins. VIF is essential for productive FIV infection of host target cells in vitro.
Statistics
?
PSSM-Id: 147807
View PSSM: pfam05851
Aligned: 4 rows
Threshold Bit Score: 366.489
Threshold Setting Gi: 82294458
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P19029   1 MSDEDWQVSRRLFAVLQGGVYNAMLYISRL-PQDEREKYKKDFKKRLLDTETGFIKRLRKAEGIKWSFHTRDYHVGYVRE 79  Feline immunodeficien...
Q66934   1 MSDEDWQVSRRLFAVLQGGIHSAMLYISSL-PEMEQNKCKRSFKKRLSDKETGFIFRLRKAEGIRWSFHTRDYYIGYVRE 79  Feline immunodeficien...
P89687   2 SGEEDWQVSRSLYQVLLGGPRRAMLYIGSIiDEKEKARKKKDLQKRMARLENRFIYWLRRQEGIRWSFHTRDYHLGFVKE 81  Feline immunodeficien...
Q84810  31 LQDEYWHLNQ-LFVTYQIGIRTPSLWLTNk-DKLD----KFLLKKKLKHLEDKWVKQIRQADGIKWSLHTREWHTSLVKE 104 Puma lentivirus 14
P19029  80 MVAGPTTPHSLRLYVYISNPLWHSQYRPGLvNFNKEWPFVNLWIKTGFMWDDIEKQNICIGGEVSPGWGPGMIGIAIKAF 159 Feline immunodeficien...
Q66934  80 MVAGSSLPDSLRLYVYISNPLWHQSYRPGLtNFNTEWPFVNMWIKTGFMWDDIESQNICKGGEISHGWGPGMVGVVIKAF 159 Feline immunodeficien...
P89687  82 LVAGSSSPGCLRLYCYISNPLWHKRYRPTL-QMNQEFPYVNCWITDKFMWDDIENQQIMKSPLPGPGWDIGMVGLVIKAY 160 Feline immunodeficien...
Q84810 105 CVAGTG--NGLKLFVYIHSPLWR-EYRPNY-DWNPNWPYANCWISRKYMWDLDDSIKILSRNRPMEGWPPGWLGVVIKAF 180 Puma lentivirus 14
P19029 160 SCGERKIEATPVMIIRGEINPKKWCGDCWNLMCLRNSPPETLQRLAMLACGVQAKSWRGCCNQRFVSPYRTPADLEVIQS 239 Feline immunodeficien...
Q66934 160 SCGERKIKITPAMIIRGEIDPQKWCGDCWNLMCLKYSPPNTLQRLAMLARGKEAKEWRGCCNQRFVSPFRTPCDLEVVQN 239 Feline immunodeficien...
P89687 161 SCPEKKYDVTIPQVIRGEKDPQEFCADCWNLICVRNSPPCSLQRLALKACGKPTESWVGCCNHRFLSPYRSPTDLLIVRE 240 Feline immunodeficien...
Q84810 181 CCKECKYDWNPMEVIRQDIDPWDYCGDCWLFIVIRNTAPGSLQRLCMLQLGRPLLSWKCKSQCTFLDWRRTPLDALVIQD 260 Puma lentivirus 14
P19029 240 KPGWCMLWRGKL 251 Feline immunodeficiency virus (isolate San Diego)
Q66934 240 KPKRNLLWTGEL 251 Feline immunodeficiency virus
P89687 241 AVPYEVLYRMKS 252 Feline immunodeficiency virus
Q84810 261 CLPWQWRVWMDL 272 Puma lentivirus 14
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap