Conserved Protein Domain Family
CENP-H

?
pfam05837: CENP-H 
Centromere protein H (CENP-H)
This family consists of several eukaryotic centromere protein H (CENP-H) sequences. Macromolecular centromere-kinetochore complex plays a critical role in sister chromatid separation, but its complete protein composition as well as its precise dynamic function during mitosis has not yet been clearly determined. CENP-H contains a coiled-coil structure and a nuclear localization signal. CENP-H is specifically and constitutively localized in kinetochores throughout the cell cycle. CENP-H may play a role in kinetochore organisation and function throughout the cell cycle. This the C-terminus of the region, which is conserved from fungi to humans.
Statistics
?
PSSM-Id: 399089
Aligned: 75 rows
Threshold Bit Score: 46.0228
Threshold Setting Gi: 485924011
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEY20065      16 PAAVSPApGTAASATLARNATNLRDTLDALAATRAGALAAGRRNAELAQEV-L-RLAEEAARRRdggsepqggggedDE- 92  Verticillium al...
XP_012431424  77 ILETMKH-LVLLSQTIIDYQKKIHEKEQQLINIRRERLSLKVYGGQKLQQIqT-MMKRQKEKQAs------------MD- 141 zebra finch
Q90ZF9       112 IVETMRD-IIKLNWEIIQAHQQARVIRENLNDIRRKRYFLKQAEGEKALRIfT-TVRKKKEVVR-------------MK- 175 chicken
NP_001107081 116 LKELTNQ-NSEICEKTIQILKETRELQDQITDVQKQRLDLKGQIKKKMQEIn--ELKQEKENQGe------------VQ- 179 zebrafish
XP_005804100 115 LKAVSAR-CMALCSQIKRLQMETRNLQDEITEIQKERLEIKRLTHEKMKETq--ELLSNKEQPDs------------EK- 178 southern platyfish
Q4RUR4        21 LKALGDR-CAGLCSHIKQLQQESRELQDEIIDIQKRRLEMKRLTHEKIKEMe--ELMAKKEPPDs------------QK- 84  spotted green p...
XP_019221403 134 LKAISDR-CMGLCSHIKHLQQESKKLQDEITEIQKNRLEMKRVTHEKIKHM---EEFSKKEYPDm------------EK- 196 Nile tilapia
XP_011276039 117 IGVKLEE-RDDLIDDIIALENEVSARQSKLNKLNQEINLKFEKSKELTSKL----IEKHKNQIS-------------NNg 178 Wickerhamomyces...
XP_007875413 128 IGLCLEN-CDNIISNLLNLHNILLKNEKKIVPLQKEVLNLFLKNKEKVNKImEiITNIKDREEK-------------ILs 193 Pneumocystis mu...
XP_015223874  21 MMATINH-TLSLCSRIEKMKQESRETEEQLLEIQKKRLELKKLNNGKMKEIq--ELKMMCDHPEr------------GK- 84  spotted gar
EEY20065      93 --ARREMQLLRAGLKASRQKWKVMKGTASAIVVGSGVDWVGDEGLRWMVLD 141 Verticillium alfalfae VaMs.102
XP_012431424 142 --VRK-IEKMLANLEKEREMTTIIQNVFQNIIVGSKVNWAEDPSLKAIVLQ 189 zebra finch
Q90ZF9       176 --IAEKLKFIHRNVQYERKVTTLVQNILQNIIVGCQINWAKDPSLRAIILQ 224 chicken
NP_001107081 180 ---QKTKERAEAVLQKYQRITTILQNVLRGIILASKVNWREDPKLSDIVMK 227 zebrafish
XP_005804100 179 --YKALLEKGQVNVETYKKMIIMAQNVLRGILLACKVNWLDEPNLREIVMT 227 southern platyfish
Q4RUR4        85 --YKAALEKGQSNLEKYKKMAVMTQNVLRGIILACKINWMDDPKLRDIAMS 133 spotted green pufferfish
XP_019221403 197 --YKAALEKGQANLEKYKKMAIMTQNVLRGILLACKVNWLDDPKLRDIAMT 245 Nile tilapia
XP_011276039 179 idNTKLKIQLQEKLKIAKNKSYNLSEEIQAFLVENGINWAKDKKLRELVLY 229 Wickerhamomyces ciferrii
XP_007875413 194 vlEKQQKEKLIKEMNDIKNRAIIVKNCLQGIILESGIDWYGNEHWRNIMLK 244 Pneumocystis murina B123
XP_015223874  85 --YSEILKQGQKNLDKYLQMVAVVKNVFQGIIIASKVNWAADSKLKDVILG 133 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap