Conserved Protein Domain Family
GAGE

?
pfam05831: GAGE 
GAGE protein
This family consists of several GAGE and XAGE proteins which are found exclusively in humans. The function of this family is unknown although they have been implicated in human cancers.
Statistics
?
PSSM-Id: 399085
Aligned: 25 rows
Threshold Bit Score: 76.2736
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_005641427   1 MSGRVRSRSRSKQGREDRGSAQPAARVVTPPPTQaE----QLKPKEKPTKTQDIIPDQGKEvEGAPVIQGPEMKSELQEV 76  dog
Q5JUK9         1 MSGHQRTRSRSRERRDDQDSNHPVGAVVAQELPSnD----QLQQEEPPIESQDYTPGQERD-EGALDFQVLGLAAYLWEL 75  human
XP_017824162   1 MSGHQRTRSTSRERRDDQESNHPVGAVVAQEPPSdD----QPQQEEPPTENQDYTPDRERH-GGRPEFQVLGLAAYIREL 75  white-tufted-ea...
XP_008987623   1 mSEHVRTRSQSSERGNDEEPSQPVEPVIVQQPTE-E----KRQEEEPPTETQGIAPSGVIEnEGAPAVQGPDVQALQQEL 75  white-tufted-ea...
XP_016798332  21 mseHV-TRSQSLERGNDQESSQPVGPVIVQQPTE-E----KRQEEEPPTDNQGIAPSGEIKnEGASAVQGPDVEAFQQEL 94  chimpanzee
XP_023489733   4 mSGHVKTRSKSAGRRDDRESSQAVGPVVAQQPSD-E----QPQLEEPPTEGQDIIPAQDIDdEGAPTVQGPDVEAAQQEL 78  horse
NP_001182293   1 MSGHVRTESKSAGRRDDGESFQPVGRLVAQQPSD-K----QPQLEKPPTESQDIIPAQDIGdEEAPVAQGLVMKAEQ-EL 74  pig
A6NGK3         1 MSWRGRSTYRSRPRLY-VEPPEMIGPMLPEQFSD-EvepaTPEEGEPATQRQDPAAAQEGEdEGASAGQGPKPEADSQEQ 78  human
PNJ15012       1 MGFQRRLIYRRRPIIY-IESSE--------ESSD-E----QPDEEESPTQSQDSTPAEEREdEGASAAQGQEPEADSQEL 66  Sumatran orangutan
XP_017823761   1 --------------------------------------------MEPSTQNLDSSPAPERMdEGASAAQGPEPETDSQEL 36  white-tufted-ea...
XP_005641427  77 AQPMTGDKSEDGPDVKGLKIPNLEPIKMPEAG 108 dog
Q5JUK9        76 TRSKTGGERGDGPNVKGEFLPNLEPVKIPEAG 107 human
XP_017824162  76 IQSKTGGERGDGLNVVGEFLPNREPVTIPEAG 107 white-tufted-ear marmoset
XP_008987623  76 ALLKIEDEPGDGPDVREEIPPTFDLTEVLEAG 107 white-tufted-ear marmoset
XP_016798332  95 ALLKIEDAPGDGPDVREGTLPTFDPTKVLEAG 126 chimpanzee
XP_023489733  79 TLLKTVDEPGDGPDVAEEILPSLEPLKMPEAG 110 horse
NP_001182293  75 SLLKIVDEPGDGPDIKEESLPSLEPIKMPEAG 106 pig
A6NGK3        79 VHPKTGCECGDGPDGQEMGLPNPEEVKRPEEG 110 human
PNJ15012      67 VQPQIGYELGDGPDAKRVCLRNEEQMKLPAE- 97  Sumatran orangutan
XP_017823761  37 VEPMTECEHGDGPDVQEMCLPNPEWVKLPQEe 68  white-tufted-ear marmoset
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap