Conserved Protein Domain Family
NolX

?
pfam05819: NolX 
NolX protein
This family consists of Rhizobium NolX and Xanthomonas HrpF proteins. The interaction between the plant pathogen Xanthomonas campestris pv. vesicatoria and its host plants is controlled by hrp genes (hypersensitive reaction and pathogenicity), which encode a type III protein secretion system. Among type III-secreted proteins are avirulence proteins, effectors involved in the induction of plant defense reactions. HrpF is dispensable for protein secretion but required for AvrBs3 recognition in planta, is thought to function as a translocator of effector proteins into the host cell. NolX, a soybean cultivar specificity protein, is secreted by a type III secretion system (TTSS) and shows homology to HrpF of the plant pathogen Xanthomonas campestris pv. vesicatoria. It is not known whether NolX functions at the bacterium-plant interface or acts inside the host cell. NolX is expressed in planta only during the early stages of nodule development.
Statistics
?
PSSM-Id: 399077
Aligned: 8 rows
Threshold Bit Score: 520.133
Threshold Setting Gi: 145573475
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
RtaDB:Rta_29960 186 METIAVLGRHEDKFk-kAVDGKGIDKLIEDEKTPPDLVRALKDLKADPQ---MMEALDKAKTGKTDGKISAKDINILQ-S 260 Ramlibacter ...
EHK54558        105 LQIVAVLNRHKDQC---PLSWKSLGDKANDPSTPPDLKAAIEGLQQDPE---LFYAIGSQGDGRCGGKITAKDLSGFSrH 178 Mesorhizobiu...
WP_006205102    133 LQIVAVLNRHKDQC---PLSWQSLADKANDPTTPPDLKAAIEGLQQDPE---LFYAIGSQGDGRCGGKIAAKDLSGFSeH 206 Mesorhizobiu...
WP_047189337    142 LQIVAVLNRHKDQC---PLSWDSLAAKLDDPSTPPDLRATIEGLQQDPE---LFYAIGSQGDGRCGGKITAKDLSGFSeH 215 Microvirga v...
Q5H6V0          308 LEIVSVLDRHKDQVd--SLSFDQLDAKINDPSTQPDLKKALKGLQKDPR---LFFAIGSQKDGKCGGKIKAQDLTDFSyY 382 Xanthomonas ...
Q8XPT2          207 LEIMSILARHKDKM---PVDWSSIQDKINDPSTPSDLKAALQALANDPA---LFFAIGSQGDGNCKGKIKAGDVSKFAdN 280 Ralstonia so...
WP_056810233    112 MDALSTLERHEGAFskhGTKISDMEKMAKDDKTPPDLRKALNTVLSDTGpdnLRDKLDGAKNGKLDHKISSKDIQKLA-D 190 unclassified...
jgi:Pmen_0233   114 EEVVSVLGRNENLLk-kPRDREGLEKLRDDPNTPTDAKKALDAVLKNPA---YYEALDQAKTGSTDGKISAKDVQKLQ-Q 188 Pseudomonas ...
RtaDB:Rta_29960 261 NNANKAFAEQKAEDFEETYIPSdNKDPNAVPRPITSNDAKRELFRYSDYLPKHVSRENLQKIVDGTAEQGKAPPQLVAAA 340 Ramlibacter ...
EHK54558        179 HSQVAEFQDRQAQSYAQNYIPS-DSAGNPQPSVMTLSDALRELYRYSENLPKNLSLADFKQIVEGESKTGKCPPQVIAAA 257 Mesorhizobiu...
WP_006205102    207 HSQVGEFQGRQAQSYEQNYIPS-DGTGNGQPQVMTASDAMRELYRYSDYLPKNLSLADFKQIVEGDAKTGKCPPQVIAAA 285 Mesorhizobiu...
WP_047189337    216 HSQVAAFQERQAQSYVQNYIPS-DGTGNGQPSAMTLSDALRELYRYSDYLPKNLSLADFKQIIDGQAKTGKCPTQVIAAA 294 Microvirga v...
Q5H6V0          383 HPQIAEYNDKKAKSYTQNYIAS-DSPDKTKASVMTKSDALREMYRYSDYLPGNLSEDEFAKIVDGDSKTGKCPPQLIAAA 461 Xanthomonas ...
Q8XPT2          281 HPQVEEYNRKKAEGYVKNYIPS-DAKPGDKPSAMTQNDALRELYRYSDYLPKKLDMEAFQRIVDGDSDVKKAPPQVIAAA 359 Ralstonia so...
WP_056810233    191 DPELKAYNEEKAKGYADNYIPSgDNGKTTEGRPITKNDAENELYKYADYLPKNMSLDELHKIVDGSSHTGKCPPQLIAAA 270 unclassified...
jgi:Pmen_0233   189 HPLIRQYADAKAETYTHNYVPS-DAAPGSAAREMTENDAMRELYLYSESLPKKLNLETLGKIADGSQSMGKCPPQVAAAA 267 Pseudomonas ...
RtaDB:Rta_29960 341 KFYVDNPDAWQKDMDR--KgpdePIRKDGLCNHVSKSIELTADEDKTLKVMGENRDVFFGGSN-LNDSKLKKIAGDPAGK 417 Ramlibacter ...
EHK54558        258 QYFVSHPDEWKQLYGGaiD----KVHKEDFLQVASSSMSLTRPELDTIETIKHNQDAFFGSGV-LTRDKLASMAQDKSLD 332 Mesorhizobiu...
WP_006205102    286 QYFVNHPDAWRQLYGGaiD----KVHKEDFLQVASAAMSLTKPELAALDTINKNQSAFFGSGD-LTREKLASMADDKSLN 360 Mesorhizobiu...
WP_047189337    295 QYFLNHPDDWTQLYGGaiD----KVHKEDFLQVASSSMSLTRTELNTLETINRNQSTFFGDGD-LTRDKLARMAGDKSLD 369 Microvirga v...
Q5H6V0          462 QYFRDHPDEWKEFSGDa-----gTMSTPDFLQKSTSEMHLTADEQKTLDTINSHQDAFYGDGKeLTRDKLDAISKDNKAD 536 Xanthomonas ...
Q8XPT2          360 EYFLQNRNEWASL--NkmDdpdkRVGKSDFLQRAASAVHLSKEDLQTVSTINSNLDVFFKDGQkITRDRLAAMSQDESLS 437 Ralstonia so...
WP_056810233    271 KYFTDHPQEWKDL-----NngkdKVSHASMEDKIAAKGQLDADQKKALDRIDADPNGAFGNK--FNRDKLQKIADDPKAA 343 unclassified...
jgi:Pmen_0233   268 KFFVQNPDKWQQFSGK--DdpsaKISRDRLCDLATENVKLSPQESKALETLKNNQDIFFKGGG-IKPDKLAKIANDPQHS 344 Pseudomonas ...
RtaDB:Rta_29960 418 PEVREAAEMLLDKRgsLLYTMLDNGKHGH----------GGnilHAADDRSIGGGDFERFMQQR---NKSIAPPQevlta 484 Ramlibacter ...
EHK54558        333 PKVQQAAAQLLSDP--LLFSLLNNSITGYkthnkffdfgGG---HTVDSGDVSKKDFARFYDGMssaNRTVQQPK----- 402 Mesorhizobiu...
WP_006205102    361 ESVRKAASQLLSDP--LLFGLLNNSITGYkthhgffdfgGG---HTVDSGNISNNDFRHFYNNMsaaNSTVQNAK----- 430 Mesorhizobiu...
WP_047189337    370 PKVQQAASQLLSDP--LLFGLLNNSITGYktdhsffafgGG---HTVDSGNISNSDFTHFYRNMstaNRTVQQTK----- 439 Microvirga v...
Q5H6V0          537 PAVKEAATQLASDP--LLFGLLNNSITGYkkph--hffgGG---HVVDSGKISQNDFRQFYDHMsaaNKTVNTPA----- 604 Xanthomonas ...
Q8XPT2          438 PAVRNAAKQLLQDP--LLYGLINNANSGYktkngffsfgG----PTVDSGVIGKKDFEKFMSSMtdaNKTVQARK----- 506 Ralstonia so...
WP_056810233    344 PEDKEAAKKFLEDP--VLFGKLDNAKQGRdi------hgAKklwQQSDDGTISRDDIKAFNKHLe--NKEVATTPan--- 410 unclassified...
jgi:Pmen_0233   345 QEVRDAAN-LLSQPnsMLFSMLDNAKHGA----------GGnffNKANDRNISKGDLNAFLQKGs--NEVAGPPQ----- 406 Pseudomonas ...
RtaDB:Rta_29960 485 eeaaaagkaaqaeksdstgqatrTADPAAARSAQAAQDMSDGLYNQPDAK--KKKGGQLRDIATFFLKAYSIIMGAVSSV 562 Ramlibacter ...
EHK54558        403 -----------------------TSVPETTAGQDAASDMMMGRADQPDTKspKKNGGAFIHTVGDVLKVAAPVLDWAATA 459 Mesorhizobiu...
WP_006205102    431 -----------------------THVPKTAAEQDAVADMMMGVADQPNIKsaKKNGGAFMHAADSVLKVGSEVLDWGATA 487 Mesorhizobiu...
WP_047189337    440 -----------------------TSVAKTAADQDAVADMMMGAADQPSIKsaKKNGGALMHALDGVLKVGSNVLDWASTA 496 Microvirga v...
Q5H6V0          605 -----------------------THEASSPDQQKAVADMLMGKDDPPAIKkpKKDVGTFQQGLHEFLKWDSKILDWMSVG 661 Xanthomonas ...
Q8XPT2          507 -----------------------THPANSEASKSAVADMGMGMEDQPDIKavKKSGGALKKAMDKILTIYSKVMDIASQV 563 Ralstonia so...
WP_056810233    411 ----------------------aTHKPKSAEDKKAVGDMVAGEMDQPDQK--KAKGGGFKKFLQGCLSVVSKIANVISKV 466 unclassified...
jgi:Pmen_0233   407 -----------------------LAKPATGAALAAQNDMHMGQETQPDQK--KEKGGGIFKFLE--------IFSYVASG 453 Pseudomonas ...
RtaDB:Rta_29960 563 LAVLAKV--PGLGLIAAPAALATSAASGAASIGAAALQGKDTKNAAMMAGIGVATTAASLVV-PGAgklvtesaKVSAKE 639 Ramlibacter ...
EHK54558        460 VGVFSFV--PVLGQVADAVSMTLACEAQAANLLRTAITGGNMKQALQEAGISIGAQAASLVAgPGV--------KLAIRN 529 Mesorhizobiu...
WP_006205102    488 VGLLSFV--PVLGELADVVSMGLETESQAANLLHTAISGGNMKLALAEAGISLGGQALSFVAgPEV--------KLAIRN 557 Mesorhizobiu...
WP_047189337    497 VGLLSFI--PGLGQLASLGSEVLQLGAQAANLVHTAISGGNMKQALKLAGLNLAAQLVGNIAgPEV--------KLAIRE 566 Microvirga v...
Q5H6V0          662 LSALNGI--PVIGEIADAAAIALESEAQAAQVVDTAIQGGDMSLALKLAGINMAGAVVGAVGgPTA--------RIGAK- 730 Xanthomonas ...
Q8XPT2          564 VGALGVI--PGLGEIADALSMGMAAGASAAKVLSTLLNGGSLKKALAEAGINLASAALGAVAgPEA--------RVALKN 633 Ralstonia so...
WP_056810233    467 AEKLGRVlpPPFNLAAKAVAVGSRAWSEGTNVAATAIQGGDVKKALRDAGLDIAGTGLNVVTnTSAgsm----itgGVKA 542 unclassified...
jgi:Pmen_0233   454 VMML--I--PGAG--------AATLAATAGRVAATTVAKEAAKQAAQHTVKEVAKDTVKETAkREFkd----aaIQGTKD 517 Pseudomonas ...
RtaDB:Rta_29960 640 GGEVAAKEGAKT 651 Ramlibacter tataouinensis TTB310
EHK54558        530 GLVKQAMEEAVS 541 Mesorhizobium alhagi CCNWXJ12-2
WP_006205102    558 GLVKKALEEAFT 569 Mesorhizobium amorphae
WP_047189337    567 GLVKKVMEHAVE 578 Microvirga vignae
Q5H6V0          731 GAAKGVAEVAAK 742 Xanthomonas oryzae pv. oryzae
Q8XPT2          634 GLTKMLVEKVAN 645 Ralstonia solanacearum
WP_056810233    543 GLNGAGGEKPKA 554 unclassified Rhizobacter
jgi:Pmen_0233   518 GLKDYAKDQARD 529 Pseudomonas mendocina ymp
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap