6S7O


Conserved Protein Domain Family
Ribophorin_II

?
pfam05817: Ribophorin_II 
Oligosaccharyltransferase subunit Ribophorin II
This family contains eukaryotic Ribophorin II (RPN2) proteins. The mammalian oligosaccharyltransferase (OST) is a protein complex that effects the cotranslational N-glycosylation of newly synthesized polypeptides, and is composed of the following proteins: ribophorins I and II (RI and RII), OST48, and Dadl, N33/IAP, OST4, STT3. The family also includes the SWP1 protein from yeast. In yeast the oligosaccharyltransferase complex is composed 7 or 8 subunits, SWP1, being one of them.
Statistics
?
PSSM-Id: 399075
Aligned: 40 rows
Threshold Bit Score: 394.338
Threshold Setting Gi: 829153501
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6S7O_F         9 VFLLALTIIASTWALTPTHY----LTKHDVERLKASL----DRPF------TNLE------SAFYSIVGLSSLGAQ---- 64 
XP_003537048  14 FLLLLLPFSFSFS-----------ISHSHRSAAINLFa----ATP------TSLE------DAYEALRVFQILGIEeknt 66  soybean
Q93Z16         7 VRFLVLILAVAICGAASvf---qpISDSHRSAALDVFvp-vDGSY------KSLE------EAYEALKTLEILGIDkk-s 69  thale cress
CBI37135      74 flVLVLILTISIHKAAS-------ILDSHQPVALELFsp-vHGSF------GSLE------ESYDALQTFQILGIEkk-p 132 wine grape
EEF32552       7 gGFLVLLVVALICSVSSSASisypISDSHRSAALELFtp-iGGSF------GSLE------EAYEALRTFEVLGIDkk-p 72  castor bean
XP_002307654   6 ggFLVLIAAALIYSSALASYifqpISDLHRSAALELFnp-lGGSF------PSVE------ETYEELRTFEVLGIDkr-s 71  black cottonwood
Q5N7W3        11 ATLLLLVIAAVAVAPLASAVr--pVSDAHRSAAAELFaaspDGSF------GDLE------TTYEAVRTFQILGVEkd-k 75  Japanese rice
EFC49240      10 rtlLAVVLVILCSASVFALTiqngLTQQDKTNIQSVLe-------------KDFKgisnkkDLFYSASTLLKISNGdi-i 75  Naegleria gruberi
EFA81631      13 VLMVSLTIGMISAAKTAPSSlsstLTASNIKSLSSMIe--sHRPSngglydNDLK------ETFYAVGALTRLSQP---- 80  Heterostelium a...
XP_009397601   9 vgFAALICAALLSISAAASIr--pISDAHRSAALELFvp-iDGSF------PSLE------ETYEALRTFQILGLGkt-s 72  wild Malaysian ...
6S7O_F        65 -VPDAKkaCty---irSNLD-PSNVDSLFYAAQASQALSgCEISI--SNETKDLLLAAV-SE--DSSV-TQIYHAVAALS 133
XP_003537048  67 pVNEDT--CqkvveslASSS---PLKDLFYALKVNAILK-CNVNGnvFKDIASRLKATVh----DASAlLDIYYSIGGLV 136 soybean
Q93Z16        70 dLSSKT--CenvvkvlQSSS--STLKDAFYALNVNGILK-CKIGEagPKDIVSQLQAGVk----DAKLlLDFYYSVRGLV 140 thale cress
CBI37135     133 dISDTT--CtlvsktlGSSS--SSLKDLFYALKVNGILK-CDIDEevFEGIKSRLQSVSn----DASSlLDFYYSIGSLA 203 wine grape
EEF32552      73 dISVPA--ChsiletlGSSS--AVSKDIFYALKVNGILK-CEVNEdvLEGIVSNLQTAVs----SASSlLDFYHSIGSLV 143 castor bean
XP_002307654  72 dISTAA--CqsvseilGSSS--STLKDLFYALKVNGILK-CDIKEdvFEGVASRLQAAVs----GASAlLDFYYSVGGLA 142 black cottonwood
Q5N7W3        76 gLIGKA--CkfaaeklASSS-SSPAKDLFHAARISGVLK-CSVDSgvYDDVATRLKAVIk----DTNSlLELYYSVGGLL 147 Japanese rice
EFC49240      76 qSAQNQ--Cv------KTISnVEGPEALYNLIASNAALK-CSP-LesYTAVQSALAKYIdESsdKTSA-ENIYSIARSIL 144 Naegleria gruberi
EFA81631      81 -IVKDSelCkqvrgliEQRS--NDIESVFYGVSILSEIK-C---LaaNPVPLSLIENAVqKSleNGNI-NELAAAVNTVF 152 Heterostelium a...
XP_009397601  73 dISNAT--CpvvldklRSPT--SSPKEFFNALRLNGILG-CEIGSqtFENVASHLHALIk----DADSlMDLYYSVISLL 143 wild Malaysian ...
6S7O_F       134 GF----GLPLASQ---------EALSALTARLSKE-------ETVLATVQALQTA------------SHLsqQA--DLRS 179
XP_003537048 137 VI----KDQDSNVdvll-advdGVFQSIKVLSQSDgrwryssDNPESSTYAAGLAleslaglislasSEFdqSKvnVVKN 211 soybean
Q93Z16       141 LA----KEQFPGThisl-gdaeAIFRSIKSLSQSDgrwryssNNPESSTFAAGLAyetlagvislapSEFdpSLiqSVKT 215 thale cress
CBI37135     204 LI----KEQASKVdvll-tdadGIFQSIKALSQSDgrwryssNNPESSTYAAGVAfealarvvalasPEIdqSRisTLGN 278 wine grape
EEF32552     144 LI----KDQSSKdvsf--edaeGVFRSIKALSQSDgrwrysfNNPESSTFAAGLAlealagvisvssSEIdqSLiaTTKN 217 castor bean
XP_002307654 143 LI----KGQTTKDdlyl-adaeGVFQSIKALSQSDgrwrynsNNPESSTLAAGLAlealagivslssSKIdqSLirTTKN 217 black cottonwood
Q5N7W3       148 SI----KEQ--GHnvvl-pdadNTFHAIKALSQSDgrwrydtNSAESSTFAAGIAlealsavisladSEVdsSMiaVVKN 220 Japanese rice
EFC49240     145 LT----KSKINVAdlkisklyeLVVKQLTSSIKQDcn----dACLKSVGFLMEAAqi---------lQSIqkSDvaSLNK 207 Naegleria gruberi
EFA81631     153 LLldakSISYDVAnl------eSAANRLVSLMDADgefklesGSDDASIINNGVAyftmarlshrlkSVAgiSN--LVDK 224 Heterostelium a...
XP_009397601 144 HI----KGQ--GVsavl-sdaeGVFHSIKALSQSDgrwrydsNNAESSTYAAGIAlealaavvsladAEVdqSKigIVKH 216 wild Malaysian ...
6S7O_F       180 IVEEIEDLVARLDE----LGGVYL---QFEE----GLETTALFVAATYKLMDHVGT-EPSIKEDQVIQLMNAIFSKK-NF 246
XP_003537048 212 GIVKLFDGIEKYEDgtfyFDEKYVgghEQRG----SLSTTSSVVRGVTAFAAVTSG-KINLPGDKILGLAKFFLGIG-IP 285 soybean
Q93Z16       216 GILKLSDSIQKYDDgtfyFDEKSVda--sQG----PISTTASVIRGLTSFAASEST-GLNLPGDKIVGLAKFFLGVG-IP 287 thale cress
CBI37135     279 DIVKLFDSIEKYDDgafyFDEKIVdarEHHG----PLSTTASVVRGLTAFADVTSG-SLNIPGDKILGLAKFFLSVG-IP 352 wine grape
EEF32552     218 DILKLFDSIEKYDDgafyFDEKHa--qENQG----PLSTTSSVVRGLTAFADVTSG-NLNLPSEKFVGLAKFLLGIG-IP 289 castor bean
XP_002307654 218 DILKLFDSIEKYDDgafyFDEKLVgahEHQG----ALSTTSSVVRGLTAFAAVTSG-SLNLPSGKILGLAKFFLAIG-IP 291 black cottonwood
Q5N7W3       221 DIVKLFDTIKSYDDgtfyFDEKHVdaaEYKG----PITTSASVVRGVTSFAAVASG-KLNIPGEKILGLAKFFLGIG-LP 294 Japanese rice
EFC49240     208 AISALTSVTKKA------ISSN-------------NVETVAIFARGLNKLATIVDV-KSKVSKEDFVALINSLVSKKdSS 267 Naegleria gruberi
EFA81631     225 VVSKLPSVVSSASD-------------SASGfvwhDLATTSSIFRGIVALTSQSEKvANTITPLQIQRIGDYLLRFK-ST 290 Heterostelium a...
XP_009397601 217 DIEKLFDSIKSYDDgtlyFDEKHVdgsEYKG----PLTTTASVVRGVTAFAAV-AG-KLNIPGDKMLGLAKFFLSIG-VP 289 wild Malaysian ...
6S7O_F       247 ESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSA--SDTHEQAILRLQVTNVLSQPLTq-AT-VKLEHA-KSVASRATVLQ 321
XP_003537048 286 GDAKDFFNQVESLAFLESNRISIPLILSLPETA--YSLTKKGQLKVKVNTVLGSAAPp-LT-VKLVRAfSTGAKDSAIID 361 soybean
Q93Z16       288 GDAKDFFNQIDALACLEDNKFSVPLILSLPSTV--ISLTKKEPLKVKVSTVLGSKAPa-LS-VKLTQAlSSKSVDSSVIN 363 thale cress
CBI37135     353 GDAKDFFNQVYSLACLESNRVSIPLILSLPATV--LSLTKNDQLKVRVNTVLGSNAPp-LT-VKLLQAfSSSSKNAFIIE 428 wine grape
EEF32552     290 GDAKDLFNQVDSLAYLESNRISIPLILSLPATV--LSLTKKDTLKVKVNTVLGSNAPpsLT-VNLVRVfSSGSKDTSIIE 366 castor bean
XP_002307654 292 GDAKDLFNQVDSLAFLESNTVSIPLILSLPATV--LSLTKKDALKVKVNTVLGSNAPp-LT-VNLLRVfRSGSKDTLLTE 367 black cottonwood
Q5N7W3       295 GSAKDCFNQIESLSFLENNRVFVPLVLSLPSKV--FSLTSKDQLKVEVTTVFGSAAPp-LR-VNLVQV-LGSDSKVITTE 369 Japanese rice
EFC49240     268 KTLSEIYHLIEGVQSFTK-PIYEPIV------VvsELKDEKGAISLQISNILGAPL---SEkVTLQSVyKGSNSDDSILP 337 Naegleria gruberi
EFA81631     291 ASLQDAFNLVIGLKSCAKNSIGQPLSVVLNPTTfdSSASGKKLVTVQIHDIFDHPV---ATqVTVAKVaLATARNTAVIS 367 Heterostelium a...
XP_009397601 290 GSTKDLFNQIDALSCLESNrISIPLILSLPATV--LSLTSKDQLKVEVTTVFGSAAPp-LT-VILVQA-SSYDKDTPVLE 364 wild Malaysian ...
6S7O_F       322 KTSFTpvg--dvFELNFMNVKFSsGYYDFLVEV-----EGDNRYIAN-TVELRVKI-STEVGI----------TNVDLST 382
XP_003537048 362 SKELRydqesgfHVLDALPKNVDvGTYVFVFEIvlhdfGSEKVYATGgQIHVPIYV-TGIIEV----------GNAEITV 430 soybean
Q93Z16       364 NQELKfdadsatYFLDSFPKNFDiGKYTFVFKIvldesAHEKVYITEaQTKVPIAA-TGAISI----------ENAEIAV 432 thale cress
CBI37135     429 NQELKfdpenavHFLDALPENVDvGNYVFVFEIllhdpEHEKIYATGsRTRVPIII-TGVIKV----------DTAEIVI 497 wine grape
EEF32552     367 NQELKydtensvYFLDALPKGVDvGNYIFVFETvfhdaAHEKVYTTGgQTQVPIFV-TGVIKVtmlxxldcrnSKKYIDM 445 castor bean
XP_002307654 368 SQELKfdpanavYTLDALPKSVDvGKYTFVFETvlhdsDHKNLYATGgQTRIPIFV-TGIIEV----------DTAEIAV 436 black cottonwood
Q5N7W3       370 TKELQfdldnnvHYLDIAPLKIDvGKYSLVFEIslqeqEHETIYATGgTNTEAIFV-TGLIKV----------DKAEIGI 438 Japanese rice
EFC49240     338 KGPVKlda--ngVEYQIKGVKLDsGIFNFDITV------------GKeAVTRSLKTaAADLKI----------RDFQLDV 393 Naegleria gruberi
EFA81631     368 NKELSd------NQLDVSELKl--GSYVADIKI-----NPSEDNFHPfTVTRTITV-SGAAAV----------RDFKLIV 423 Heterostelium a...
XP_009397601 365 NQELQfdtenniHYLDILPLKIDvGKYTLEFEIslhdpENLNIYATGgRANALAFL-TGTIKV----------DKAQIGV 433 wild Malaysian ...
6S7O_F       383 VDKDQSIAPKTTRVtyPAKAKGTFI--ADSHQNFALFFQLVDVnTGAELTPHQTFVRLH-----NQKTGQEVVFVAEPDN 455
XP_003537048 431 LDSDLGSAETQKKLdlAGNDAVSLS--ANHLQKLRFSFQLTTP-HGHVFKPHQAFFKLR-----H-ETKVEHIFVVGNTG 501 soybean
Q93Z16       433 LDSDIGSVESQKKLdlTKDGAVSLS--ANHLQKLRLSFQLTTP-LGNAFKPHQAFFKLK-----H-ESQVEHIFLVKTSG 503 thale cress
CBI37135     498 LDSDLGSVETKRKLdlAGENDVSLS--ANHLQKLRLSFQLATP-LGHAFKPHQAFLKLK-----H-ETKVEHVFVVGSSG 568 wine grape
EEF32552     446 LDA-----SSSDMLdlAGENLVSLS--ANHLQKLRLSFQLTTP-LGHAFKPHQAILKLR-----H-ETKVEHIFVVANSG 511 castor bean
XP_002307654 437 LDSDLGSIETKKKIdlAGDNTVSLS--ANHLQKLRLSFQLSTP-LGHAFKPHQAILKLT-----H-ETKVEHIFLMGSSG 507 black cottonwood
Q5N7W3       439 SDNDAGTVESVQKIdlQKDTSVSLS--ANHLQKLRLSFQLSTP-LGKTFKPHQVFLKLK-----HDESKVEHLFVVPGSA 510 Japanese rice
EFC49240     394 GK------FSRSNVayPKTLEEKLTidVDSNNRIRVNFALAGVa------PHQVFLRIG-------NCKNEAIFNIKQQH 454 Naegleria gruberi
EFA81631     424 ADNKEALANSKQIFtvESQNQLSLE--LPAAKTARIFFRVVS--GDQPFVAQQVGVRFVskvnpSIETVVQAVFSVD--- 496 Heterostelium a...
XP_009397601 434 FDSDAESAATMQKLdlSQDNRISLA--ANHLQRMRLTFQLVTP-LGHNFKPHQVFLKLR-----H-ESKVEHIFALESSA 504 wild Malaysian ...
6S7O_F       456 KNVYKFELDT-SERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEE--APSTV----LSQNLFTPKQEIQH 528
XP_003537048 502 -KKFEKVLDF-LGLVEKLFYLSGKYEIELTVGDAVMENSFLRLLGHVELDLPEAPekAPRPPpppvDPYSRYGPKAEITH 579 soybean
Q93Z16       504 -KKSELVLDF-LGLVEKLYYLSGKYEIQLTIGDASMENSLLSNIGHIELDLPERPekATRPPlqstEPYSRYGPKAEISH 581 thale cress
CBI37135     569 -KDFAIVLDF-LGLVEKFFYLSGRYDIQLTVGDAVMENSFLQALGHVELDLPEPPekAPRPPpqpvDSYLRYGPKAEIAH 646 wine grape
EEF32552     512 -KKFEIVLDL-LGLVERFFYLSGRYTIQLTVGDAVMENSFLKVIGHVDLDLPEAPenAPRPPpqpvEPYLRYGPKAEITH 589 castor bean
XP_002307654 508 -KEFEIILDF-LGLVEKFFYLSGRYNVQLTVGDAVMENSFLKAVGHIDLDLPEAPekAPQPPaqplDPNLIYGPKAEIAH 585 black cottonwood
Q5N7W3       511 -RQFKIVLDF-LGLVEKFYYLSGRYDLELAVGDAAMENSFLRALGHIELDLPEAPekAPKPPaqavDPFSKFGPKKEISH 588 Japanese rice
EFC49240     455 QPNYNLDLGLdRVVGPALKYESGEYKVQIFIGDATLSTPIHWTVATVVINFSKQIekTE--------EELLYQPRELITH 526 Naegleria gruberi
EFA81631     497 --SYSYVINS-RDLGKLLNFQSGAYAVDVLVGDSSIA-PLNWQVGQLTLNFDQAAtgTT--------RYPVHQP---IDH 561 Heterostelium a...
XP_009397601 505 -RQFKIILDF-LGLVEKFYYLSGRYEIDLAIGDAAMENSFLRVLGYIDLDLPEPPekASRPPpqpvDPYSRFGPKPEISH 582 wild Malaysian ...
6S7O_F       529 LFREPEKRPPTVVSNTFTALILSPLLLLFALWIRIGANVSNFTFA----PSTIIFHLGHAAMLGLMYVYWTQLNMFQTLK 604
XP_003537048 580 IFRSPEKRPHQELSLAFLGLILLPFIGFLVGLLRLGVNLKNFPGStvpaTFGILFHVGIAAVLLLYVLFWLKLDLFTTLK 659 soybean
Q93Z16       582 IFRIPEKLPAKQLSLVFLGVIVLPFIGFLIGLTRLGVNIKSFPSStgsaISALLFHCGIGAVLLLYVLFWLKLDLFTTLK 661 thale cress
CBI37135     647 IFRAPEKLPPEQLSLAFLSLTILPLIVFLIGLLRLGVNLKNFPTSvvpaTFAILFHLGLAAVLLLYVLFWWKLDLFTTLK 726 wine grape
EEF32552     590 IFRAPEKLPPKELSLTFLGLTLLPFIGFLVGLLRLGVNLKNFPSSavsaTFAFLFHFGIAAVLFLYVLFWLKLDLFTTMK 669 castor bean
XP_002307654 586 IFRVPEKLPPKELSLTFLGLTLLPFLGFLLGLLRLGVNLKNFPSSsvpaMFAALFHLGIAAVLLLYVLFWLKLDLFTTLK 665 black cottonwood
Q5N7W3       589 IFRSPEKRPPKELSFAFTGLTLLPIVGFLIGLMRLGVNLKNFPSLpapaAFASLFHAGIGAVLLLYVLFWIKLDLFTTLK 668 Japanese rice
EFC49240     527 IFRAPEKRAGSEIASLFSLVVFAPLAIFLIGLITVRFNFGGCPSGla-gLLAPVFVGLLGVLVGILAMYFISWDIFVTMK 605 Naegleria gruberi
EFA81631     562 RFRVPESRPPQVVSQTFTLLVLAPFVIFLIGLPVLGANLNRFPGGmg-fIYTVAFIGCAALVGLLIVTYWFSLTMVVTLR 640 Heterostelium a...
XP_009397601 583 IFRSPEKRPPKELSFSFLALTIVPLVGFLIGLLRLGVNFKGFPSSsvpaLFSILFHAGIAAVLLLYGLFWLKLDLFMTLK 662 wild Malaysian ...
6S7O_F       605 YLAILGSVTFLAGNRMLAQQ 624
XP_003537048 660 AFGLLGAILMFVGHRILSHL 679 soybean
Q93Z16       662 ALSLLGVFLLFVGHRTLSQL 681 thale cress
CBI37135     727 ILGLLGVFLLFVGHRLLSHL 746 wine grape
EEF32552     670 TLGFLGVFLMFVGHRILSHL 689 castor bean
XP_002307654 666 ALGFLGAFLMFVGHRILSHL 685 black cottonwood
Q5N7W3       669 YLSFLGVFLVFVGHRALSYL 688 Japanese rice
EFC49240     606 YLGLAGIAITLVGAKVLSGV 625 Naegleria gruberi
EFA81631     641 YLGLLLIPTVFFGQKTLSHF 660 Heterostelium album PN500
XP_009397601 663 ALGLLGVFLIFVGHRTLSHL 682 wild Malaysian banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap