Conserved Protein Domain Family
DUF842

?
pfam05811: DUF842 
Eukaryotic protein of unknown function (DUF842)
This family consists of a number of conserved eukaryotic proteins of unknown function. The sequences carry three sets of CxxxC motifs, which might suggest a type of zinc-finger formation.
Statistics
?
PSSM-Id: 399073
Aligned: 56 rows
Threshold Bit Score: 102.742
Threshold Setting Gi: 122052312
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CDS40058      13 MQNRYTEAISNAIKEWDTKFLRKMQSVYFGCGKKCCDNKDFdTEQVQSCIEHCEKPVSAAQSLVQGELNQLQSRFQTCVR 92  Echinococcus mu...
O22831        17 KVNEVSSASQSLLSPVQDHINFTLQKAYFKCAYECFDRTRT-HAEISRCAESCSVPITNAQNYFDNEMSVFQERLNRSLV 95  thale cress
Q5BQ23        19 KLEEVNATAQSQLSPIQDHINFTLQQAYFKCAYECFDRNRK-QEEIANCVEHCSVPVVNAQQHFEGEMSQFQERMNRSLM 97  thale cress
XP_009144052  19 KLEEVNVAAQSQLSPIQDHINFTLQQAYFKCAYECFDRRRN-QEEISNCVEHCSVPVVKSQQHFENEMAQFQERLNRSLV 97  field mustard
XP_006350701  19 KLNEVNTAAQTQFAGIQDHVAFTLQQAYYRCAYECFDRRRN-QEEIGRCVEHCSVPVHNAQNLFQNEMAKFQERLNRSLM 97  potato
XP_009416024  19 KLEDVNAAAQKQLSPIQDHVNFTLQQAYFKCAYECFDRRRK-QEEISNCVEHCSVPVLNANNMVETEMAKFQERLNRSLM 97  wild Malaysian ...
Q53L24        19 KLEEVNAAAQKHLAGVQDHVNFTMQQAYFKCAYECFDRRRS-QEGINNCVENCSVPVLTANNVVETEMAKFQERLNRSLM 97  Japanese rice
XP_006858782  17 KLNDVNLEVQKQLSGVQDHVNFTLQQAYFKCAHECFDRRRR-QEDINDCVEHCSVPVMQANGLVQDEMAKFQERLNRSLM 95  Amborella trich...
ACU15017      19 KLEEVNVAAQTNLAPVQDYVNYTLQKAYFKCAYECFDRSKR-QEEISSCVENCSIPLSNVQHTFDHEMAQFQERLNRSLM 97  soybean
XP_003526256  19 KLEELDEAYQTKISHVYDYANFTLPKDFFKCGYECFDGSKR-QEEVINCVNNCADRLTKVQKALNNEINMFEEKMGKSVM 97  soybean
CDS40058      93 ECSHRAHDKFkgaddtlTEAQRILVQKETLVCVNKCVEEQIANaIPATVR 142 Echinococcus multilocularis
O22831        96 VCQDKFEVAK-------QQKTRSEAVNDLEHCVNQTVDEAVKT-LPNLVS 137 thale cress
Q5BQ23        98 VCQDKFEAAK-------LHKNRGDAAKAMESCVNTSIEDSLDT-LPHIVQ 139 thale cress
XP_009144052  98 VCQDKFEAAK-------LQKIRPEAVNEMERCVHKAIEENLNT-LPHIVQ 139 field mustard
XP_006350701  98 VCQDKFESAK-------LQKNKSNATMELESCVDQSVHDSINV-LPHLVD 139 potato
XP_009416024  98 VCQDKFEAAK-------LQKIKTDAMTDLESCVNKAIDDSLGA-LPHVVD 139 wild Malaysian banana
Q53L24        98 VCQDKFEAAK-------LQKMKTHATEELEACVNRSIDDSIRV-LPHLVD 139 Japanese rice
XP_006858782  96 VCQDKLETAK-------LQPQLGTAMNQLESCVDHAIQDNIRM-LPHIVD 137 Amborella trichopoda
ACU15017      98 VCQDKYEAAR-------LQK-KNDAMNDLVSCADQSIQESIKT-LPHLAN 138 soybean
XP_003526256  98 VCQLKHDEAK--------LQQKAGAGPDLVSCLDQAIQENIKF-LPDINK 138 soybean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap