Conserved Protein Domain Family
NinF

?
pfam05810: NinF 
NinF protein
This family consists of several bacteriophage NinF proteins as well as related sequences from E. coli.
Statistics
?
PSSM-Id: 399072
Aligned: 2 rows
Threshold Bit Score: 97.9435
Threshold Setting Gi: 45645193
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q38666  1 MLSPSQSLQYQKESVERALTCANCGQKLHVLEVHVCEACCAELMSDPNSSMYEEEDD 57  Salmonella virus P22
Q38666  1 MLSPSQSLQYQKESVERALTCANCGQKLHVLEVHVCEACCAELMSDPNSSMYEEEDD 57  Salmonella virus P22
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap