Conserved Protein Domain Family
Papilloma_E5A

?
pfam05776: Papilloma_E5A 
Papillomavirus E5A protein
Human papillomaviruses (HPVs) are epitheliotropic viruses, and their life cycle is intimately linked to the stratification and differentiation state of the host epithelial tissues. The kinetics of E5a protein expression during the complete viral life cycle has been studied and the highest level was found to be coincidental with the onset of virion morphogenesis.
Statistics
?
PSSM-Id: 147756
View PSSM: pfam05776
Aligned: 5 rows
Threshold Bit Score: 58.2325
Threshold Setting Gi: 81920936
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q02268  3 LQVVPVDFTAKATSQSLLPLLIALTVCFLSIIILIFVSEFLLYSSVLVLTLLLYLLLWLLLTPPLQFFLLTLSLCFLPAF 82  Pygmy chimpanzee papil...
O37389  3 LQVVPVDVTTTTTNASLLPLLIALTVCLISIILLVFVSEFVIYSSVLVLTLLIYLLLWLLLTTHLQFYLLTLSLCFIPAF 82  Common chimpanzee papi...
Q02267  1 MEFIPVDVSTQATSKSLLPLVIALTVCVVSIITILCISEFLVYTNVLVLTLILYVLLWLLLTTPLQFYLLTLSLCFLPAL 80  Human papillomavirus t...
Q8B5W5  1 MDLIPIDGTIGTTSTSILPVVIAVFVCIVSIVLIIAITDFFVYTSILVLTLILYLLLWLLLTSALQFYTLTLCVCYLPAF 80  Human papillomavirus t...
P04017  1 MEVVPVQIAAATTTTLILPVVIAFAVCILSIVLIILISDFVVYTSVLVLTLLLYLLLWLLLTTPLQFFLLTLCVCYFPAF 80  Human papillomavirus t...
Q02268 83 CIHQYILQTQQ 93  Pygmy chimpanzee papillomavirus type 1
O37389 83 SVHQYILQTQQ 93  Common chimpanzee papillomavirus 1
Q02267 81 CVHQYILQTQE 91  Human papillomavirus type 13
Q8B5W5 81 SLHLYILHNLE 91  Human papillomavirus type 74
P04017 81 YIHIYIVQTQQ 91  Human papillomavirus type 11
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap