Conserved Protein Domain Family
SIKE

?
pfam05769: SIKE 
SIKE family
This family consists of several eukaryotic proteins. Suppressor of IKBKE 1 (SIKE) is a physiological suppressor of IKK-epsilon and TBK1, which are two IKK-related kinases involved in virus- and TLR3-triggered activation of interferon regulatory factor 3 (IRF-3). Other members of this family are circulating cathodic antigen (CCA), found in Schistosoma mansoni (Blood fluke), and FGFR1 oncogene partner 2, which may be involved in wound healing pathway.
Statistics
?
PSSM-Id: 399056
Aligned: 33 rows
Threshold Bit Score: 115.808
Threshold Setting Gi: 163776157
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002402068   2 SVSVQQILGEARRLVGRLREQDSSADQLLAQA----HTLGQGVEAMR---QYNEE--LSQLATNSSvgtglPRPRAALVL 72  black-legged tick
Q0IG53         2 SVTFEQIILDAKRIANRLKDREALGDSLLLES----ESVNKQIESMR---QFQDD--IDILNKLAR-----DRSNNQLIT 67  yellow fever mo...
EDW51932       3 NLSVGQIIMDAQRMASRVKDLDALGTALLEEA----ENNNRLVESLR---QYQDD--IESLNRISN-----NKTNADMVN 68  Drosophila sech...
XP_974301      2 SLTIQQIITDAKRLAGRLKDRDTIADTLLNET----NAITKKIDAMK---QFQEE--VDVLNEVAN-----QKPHSQLIA 67  red flour beetle
XP_015781940  11 isDINKIVQDAKDLYEKLIEDEETANQLLCKA----TFLNNAAVTMV---EYQDI--IDDLDEDSK-----DNPNPSQTS 76  two-spotted spi...
XP_004995271  73 gqgrnktlAVAERVRKAVDGHLDAADKAMELAakarSRLKHSIEVKA---ALRDVtaVKGESKATQatdtsSG------- 142 Salpingoeca ros...
EDQ89777       1 -metEQQLQAVKALSARLSQDAHSAEAMVKQAlelkHLLEKNLELMGtsqAASEE------------------------- 54  Monosiga brevic...
XP_001954507   7 tgTLGGVLKKTHELVSGLDEMQVTTDSLISLG----ESVNQDLVNCS---KYRDElvLKHLTEHSK-------------- 65  Drosophila anan...
XP_001999166   5 adavtGLIIKAQKVSSDFNDLIQKTTCLLADC----ESVDKKFFDSC---GVQEDqlLKNLVKYCN-------------- 63  Drosophila moja...
EFX71933       2 SVSVQQILADAKRLAGRLKDHDSSADLLLSQA----QAMFCQVDAMK---EYQEE--LVELNTAAH-----QRPHLDLIA 67  common water flea
XP_002402068  73 SIQQENRHIRELQQENRELVATLKEHQSALELIMAKYREQVTRLGSTCQAEEKLGIGA---------SAASALAalpqch 143 black-legged tick
Q0IG53        68 IIHQENPQIREIQQENRLLKAALEDHQHALEHIMTKYREHTQSKILNTKVNFVEAFSKhqq---fneQKDEVIR------ 138 yellow fever mo...
EDW51932      69 RIQQQNINSSEILKENRELKIFIEDYERAMELMMQKYREHTVSKVLDSKFSFKELYNE---------RMWQVIR------ 133 Drosophila sech...
XP_974301     68 NIQKENRHLREIQQENRELRAALEDYQTTLEHIMTKYREHTTEEIYKTRIDFKALQDK---------QYDEIIK------ 132 red flour beetle
XP_015781940  77 AIITESRQLNQLQNENAQLKMALEDHQFALELIMSKYRQQVCRFLNYQKCQKMPMIKSs--------CSTETVH------ 142 two-spotted spi...
XP_004995271 143 ----DAQFLKDLVHENRELHAFVGEMKTTMQVVVDHRRKQIDELLRIQDEARADAARTkqeaddkvaALEKEVT------ 212 Salpingoeca ros...
EDQ89777      55 ----QEGWLTDMAKENYELHAMVDELLSALHVLMQKHRQQVSALRTRNQETVEDAQRQieaerqrsrRLELEVV------ 124 Monosiga brevic...
XP_001954507  66 ----DDQQVMLL-RENAELRNTVDEYQKGIELIMSKYREHSDGNIFDDTYAVRERYVS---------GMSKIVD------ 125 Drosophila anan...
XP_001999166  64 ----DDERIQQL-LENAELKQTVEDYKEGVKIIMEKFRKHCQQNVLGERFNLRRRYVG---------QLQEMVN------ 123 Drosophila moja...
EFX71933      68 NIQQENRQLRALENENKELKSALEEHQNTLELIMSKYRQQISRLLEASHTEKNLVHLL---------PDTRKAE------ 132 common water flea
XP_002402068 144 HLADKVCEMAAVMRRAAEVDEE-RDAKETELLTRLKAENGVLRQLLEIG 191 black-legged tick
Q0IG53       139 QQTQKIQEMAAVMQRASQLDEE-KFNQEQEFLSKLITENKGLRELLEIS 186 yellow fever mosquito
EDW51932     134 EQREKINEMAAVMQLAASVDDG-VVQRELQTISQLRLENETLRELLQIS 181 Drosophila sechellia
XP_974301    133 HQAEKIHEMAAVMEQAALIDED-RMVCNEEIIARLKLENQGLREMLGIA 180 red flour beetle
XP_015781940 143 QLSTRIKDMSQVMMDAIEADED-SQVKRDRIISQLKVENDTLRELVKIA 190 two-spotted spider mite
XP_004995271 213 RLNAKIEEMQQVMCAAVEADAGtSVDALAQEIARVETENSQLRELLLVc 261 Salpingoeca rosetta
EDQ89777     125 QLTSKIEEMEKVMCAAVAVDER-DDLDLIADVVAVAQENQQLRDLLRVS 172 Monosiga brevicollis MX1
XP_001954507 126 DQDARIEHMLQMMKLTADLEEI-DSEGNQRIIRQLTGENEEMRRQLQIS 173 Drosophila ananassae
XP_001999166 124 NLEKRIEEMTLIMLCSISVEEH-NSNENQRIIRQLTKENDEMRRKLQIY 171 Drosophila mojavensis
EFX71933     133 EQAEKINDMIGVMETAIKLDDS-YVQKEIELFSKLTTENRVTRRavpnv 180 common water flea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap