6KAC


Conserved Protein Domain Family
PsbQ

?
pfam05757: PsbQ 
Oxygen evolving enhancer protein 3 (PsbQ)
This family consists of the plant specific oxygen evolving enhancer protein 3 (PsbQ). Photosystem II (PSII)1 is a pigment-protein complex, which consists of at least 25 different protein subunits, at present denoted PsbA-Z according to the genes that encode them. PsbQ plays an important role in the lumenal oxygen-evolving activity of PSII from higher plants and green algae.
Statistics
?
PSSM-Id: 399050
Aligned: 21 rows
Threshold Bit Score: 146.801
Threshold Setting Gi: 307102864
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6KAC_Q         9 TRPAVASRRGAVVVRAS---------------GESRRAV-----LGGLLA--SAVAAVapkAALa-LTPvdlfDDRSVRD 65 
EDQ60366      32 SSAAVVVKCGPVQVRAHse------------eAQNRRAF-----LSLAAAslAATALAgnaRA---LEDiklaPPPPPFG 91  Physcomitrella ...
Q6EP57        21 ASSPTSARRRGTASQADaaaaagerhqrggpqSATRRLAvaastALAATAalSARRPAappPAMa-AEAaavpPPPPGPG 99  Japanese rice
XP_015644740  21 LRPTPR-RLLLLVAACS---------------TGGRRSAclsvgLAAAAAtiFQHH-----PACa-ATD----DEPANNG 74  Japanese rice
XP_003557699  31 PRPRPSR---LITCQASe--------------QSSRRSAclsigLGLATAavLHTS-----PAHa-ADNtdedPEPANNG 87  stiff brome
Q9SGH4        21 PESRKTGKSSGFACRRTeefqe------pdsvQITRRMT-----LGFAVSigLTGILGennVSLa-----------QDNG 78  thale cress
EFN51130      19 aaPAPRASRAAVVVRASg--------------EESRRAV-----LGGMLAgvAA-------LAAspAQAldliDDRKARS 72  Chlorella varia...
XP_002947155   9 SRPAVASRRGVVVVRAS---------------VESRRAV-----LGGLLAstVVALTSankAQAa-ATPvdlfDDRKVRE 67  Volvox carteri ...
XP_001701331   9 TRPAVASRRGAVVVRAS---------------GESRRAV-----LGGLLAsaVAA--VapkAALa-LTPvdlfDDRSVRD 65  Chlamydomonas r...
XP_006658201  15 LRPSPRRRLLLVVCQCNcn------------aSAGRRSAcvslgLGLGLAatLVQQQQ---NAAl-AAD----EEPANNG 74  malo sina
6KAC_Q        66 ----------RGFDLI------YEARDLdlpqnVREGFTQARASLDET--KKRVKESEARIdADLDVFIQKSY--WTEAR 125
EDQ60366      92 g--------lPGTESA------DQARELdl--pLKERFYLQPKTPQEA--ADRIKEAIKAV-KDVKPLIQKKA--WPYIQ 150 Physcomitrella ...
Q6EP57       100 t--------vPR----------WGTRSY-----VRERFFEPGLTAEEA--AARIRQTAEGM-RTLRPMLETMS--WKYVL 151 Japanese rice
XP_015644740  75 wwltefplpvPKIVNKelnngeTGSRTF-----VRNGIYIADIGPSYAahAYRLRSTAFDL-LALEDLLGNNAdrANYVT 148 Japanese rice
XP_003557699  88 wwltefplpvPKIRNKeinndeTGTRSF-----VKNGIYMADIGPSFAahAYRLRSNAFDL-LALEDLLGKDA--SNYVN 159 stiff brome
Q9SGH4        79 fwidg-plpiPPIYNNivn-ekTGTRTF-----IKKGVYVADIGTKGR--MYRVKKNAFDL-LAMEDLIGPDT--LNYVK 146 thale cress
EFN51130      73 ----------AGFDII------YEARDLdlpqaTRDGMSQIRADVAAA--KARIAESEKRIdSELEGYISKAY--WTQGR 132 Chlorella varia...
XP_002947155  68 ----------TGFDLI------YEARDLdlpqsARDGLDQARGSIDAT--IKRVKESETRIdADLEGFIKKNY--WTEAR 127 Volvox carteri ...
XP_001701331  66 ----------RGFDLI------YEARDLdlpqnVREGFTQARASLDET--KKRVKESEARIdADLDVFIQKSY--WTEAR 125 Chlamydomonas r...
XP_006658201  75 wwltefplpvKKIVNKelnnaeTGSRTF-----VRNGIYIADIGESYAahAYRLRSTAFDL-LALEDLLGNHAdrANYVT 148 malo sina
6KAC_Q       126 EQLRRQVGTLRFDLNTLASTKE-KEAKKAALGLRKEFIQAVEDLDFALREKDQASAAKKLEITKAKLDSVLAAV 198
EDQ60366     151 NGLRSSASYLRYDLSTIEVSKP-KAEKKAFKALKDKALDSLNNLDYAARIKSPPKADKAYAETVALLDQVLSQi 223 Physcomitrella patens
Q6EP57       152 FYVRLKSKYLDLDLTTAMFGVP-EARRADYVRVANELVDNMTEFDRFVRTPKVYESYLYYEKTLKSLDDVTEFL 224 Japanese rice
XP_015644740 149 KYLRLKSTFMYFDFDKLISAAS-DDQRPPLLDLATRLFDSFERLQKACGTKDDTQIGSSYADTKIILQEVMAKM 221 Japanese rice
XP_003557699 160 KYLRLKSTFMYYDFDKLITAAD-ADSKPPLIDLANRLFDSFERLQSAVTSKEDDAIGSRYADTKVILQELMTRM 232 stiff brome
Q9SGH4       147 KYLRLKSTFLFYDFDNLISAAA-SEDKQPLTDLANRLFDNFEKLEDAAKTKNLAETESCYKDTKFLLQEVMTRM 219 thale cress
EFN51130     133 NELRRQIGTLRFDINALADGLP-KAAKKEALAARADFLAAVEKLDYALVKKNGSDAAKALAETKATLDAVIAKL 205 Chlorella variabilis
XP_002947155 128 EQLRRQVGTLRFDLNTLASAKGvKAEKKKALELKKEFIQKVEDLDFALREKDETSALKKLEAAKSALDSVLAYV 201 Volvox carteri f. nag...
XP_001701331 126 EQLRRQVGTLRFDLNTLASTKE-KEAKKAALGLRKEFIQAVEDLDFALREKDQASAAKKLEITKAKLDSVLAAV 198 Chlamydomonas reinhar...
XP_006658201 149 KYLRLKSTFMYYDFDSLLSAAA-ADLRPPLLDLATRLFDSFETLQRATATKDDAQIAASYAHTKTILHEVMAKM 221 malo sina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap