Conserved Protein Domain Family
S-antigen

?
pfam05756: S-antigen 
S-antigen protein
S-antigens are heat stable proteins that are found in the blood of individuals infected with malaria.
Statistics
?
PSSM-Id: 399049
Aligned: 2 rows
Threshold Bit Score: 147.158
Threshold Setting Gi: 94730422
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q03400         1 MNRILSVTLCLFFIYLYIYKTYGKVKNTDEGLSNIYGAKYYLRSGLFNEKNGKGQKYEDLEEEKEGENDDEEDSNSEESN 80  Plasmodium falc...
XP_001347627   1 MNRILSVTLCLFFIYLYIYKTYGKVKNTDEGLSNIYGAKYYLRSGLFNEKNGKGQKYEDLEEEKEGENDDEEDSNSEESN 80  Plasmodium falc...
Q03400        81 NDEENELIKGQE 92  Plasmodium falciparum 3D7
XP_001347627  81 NDEENELIKGQE 92  Plasmodium falciparum 3D7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap