Conserved Protein Domain Family
REF

?
pfam05755: REF 
Rubber elongation factor protein (REF)
This family consists of the highly related rubber elongation factor (REF), small rubber particle protein (SRPP) and stress-related protein (SRP) sequences. REF and SRPP are released from the rubber particle membrane into the cytosol during osmotic lysis of the sedimentable organelles (lutoids). The exact function of this family is unknown.
Statistics
?
PSSM-Id: 399048
Aligned: 29 rows
Threshold Bit Score: 235.256
Threshold Setting Gi: 168053676
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_010234141   22 RPRLRRLEFVHVAAAQAALCLAGLYALARDHSGPLRPGVDAVESAVRGVAGPVVGRFKDVPLHVLAFVDRKVDGTVQELD 101  stiff brome
XP_001779261    7 SADLKYLGLVHALVLQAAAYLATLYAYAKDSSGPLKPSVDNVEGTVKTVVGPVYQKVEGKPLQLLQYVDSKVDETISYVD 86   Physcomitrell...
ERN09937        9 DLELKYLGFIKIAAIKAIICILSLYEYAKGNSGSIRSHIDKVEGHVKTVVGPVYEKVNGVPLNILKFIDGKVDENLGNIQ 88   Amborella tri...
XP_006352188   12 EVNLKHLGFVRVLALNTAVLVSNLYDYAKQNSGPLRSTVGTVENAVTTVVRPVYERFKGVPDEVLVFLDKKVDDGTAKFD 91   potato
XP_019078967 1156 KRELKHLGFVRIAAIQALVCVSNLYYYAKQNSGPLRSTVGAVEDAVTAVISPVYDKFKGVPDHLLVFMDKKVDEVSAKFD 1235 wine grape
XP_009105122   10 ELGLKHLGFVRVAAIHVLVSLSSLYDYAKQNSGPLKPAVGKVEGAVTTVVTPVYNKLKNVPDTLLLFLDHKVGEASDKFD 89   field mustard
KRH42669       15 EEELKHLGFVKIAAMKALVCVSNLYGFAKQNSGLLRSAVGTVEDTVTTVLGPVYHKFNAVPNHILLFVDNKVDEAAHKFD 94   soybean
KRG97418       14 NKDLKHLGFVRIAAIQTFVIVSNLYEYAKQNSGPLRSVVGTVENTVTTILGPVCNKFKDVPDDVLVFVDKKVDEASHKFD 93   soybean
EEF47471        9 SKELKHLGFVRMVAVQTLVCVSNLYDYAKQNSGPLRSTVGTVETAVTTVVGPVYQKFKDLPDHLLVFVDNKVDEGTQKFD 88   castor bean
XP_002297837   10 DLDLKHLGFVRIAAIQVLVCVSNLYDYAKRNSGPLRSAVGTVEGTVNAVVGPVYEKFKGVPDHLLVFLDHKVDEATIKFD 89   black cottonwood
XP_010234141  102 KHLPSSLKAASARAYAAAQGVPEAAREITSEAQRSGLSGAArvaygkvepvakdvlgkiepaaKDLYTRYEPAAEHLAVS 181  stiff brome
XP_001779261   87 GVVPKYVKDKSYQALDVAKQAPDAARGLVSDVQSRGVYSTA----------------------SSLYERYEPVAEQLTFE 144  Physcomitrell...
ERN09937       89 QYAPEFVKGFYSKASSVARKAPELYEKVATDIKERGAAKVG----------------------KEACAKYKPIVEDYAIK 146  Amborella tri...
XP_006352188   92 ERAPPLAKKVVSKIQSLFQKASEVAQDLSKDIQEAGPRAAI----------------------YHAGELSKQFATSRVAV 149  potato
XP_019078967 1236 KHAPPVAKEVVGQAQCLVLKASKTAQTLVSEAKAGGPSAAL----------------------QHAATAYKLFMLTQLVK 1293 wine grape
XP_009105122   90 KHAPPVAKKVVSRANVLIQTTTEKAQRFVKEARTGGPRGAF----------------------NYAAAEYKCFLVTNSVR 147  field mustard
KRH42669       95 EHAPSLAKQVASQVTCLVQEVTHKAEKVVSEAQSGGARAAA----------------------NYVATESKQIVLFGSVK 152  soybean
KRG97418       94 EHAPPFAKHIADQAKGVIQKVTCEAGKVASEAQSGGPRAAV----------------------HYVATESKHFVLINSVK 151  soybean
EEF47471       89 KHAPPVAKQVASQAQTLMQVALQKVQELVNEARVGGARAAV----------------------HFAAKESKHLALTQSVK 146  castor bean
XP_002297837   90 KRAPPVAKQVVSQARYLIEKASEKAKVLANEFQAGGPRAAV----------------------HYVSTESKHLFLTESVK 147  black cottonwood
XP_010234141  182 TWRALNGLPLFPHVAQIVVPTAAYWSEKYNSVIASAAQQGYTGARYLPAIPTERIAKVFGE 242  stiff brome
XP_001779261  145 AWQKLLTLPLVPQAVNVAAPAAKFGVVQYNKLAEILKSKNLPLTAYIPVVPIEKLEKAMKp 205  Physcomitrella patens
ERN09937      147 ACFQLQRLPFLAQVAQVAGPTAGFLCFKYNHLVS----KGYAPFCYLPRFPLEEIIKAIng 203  Amborella trichopoda
XP_006352188  150 LWFYVNHCPPLHGIAQMAAPTAANWSEKYNHFVADLQEKGYSIVSYIPLIPVEEISKAYKQ 210  potato
XP_019078967 1294 LWFILNKVPLFHTVADMAVPTAAHWSDKYNHVVTDMSVKGYTIFGYFPLVPIDKIAKTFKQ 1354 wine grape
XP_009105122  148 VWAKLNRFKPIHAVGNKAFPVAAHVSGIYNDLVTDMTQMGYPVVGYLPLVPVDDIVKAYEK 208  field mustard
KRH42669      153 LWTGLNHYPPFHAVAEMAVPTAAHWSEKYNNVVKGTSEKGYAVFDYLPLIPIDDIAKAFKH 213  soybean
KRG97418      152 LWNGLNHYPPFHALSEMAIPTVAHWSEKYNHVIKAMTQKGYSFVGYLPLIPIEEIAKAFKQ 212  soybean
EEF47471      147 VWIKLNQFPAVHTVADMAVPTAAHWSEKYNHVIKDMTQKGHTLFGYLPLVPVDEIAKAFKQ 207  castor bean
XP_002297837  148 VWVKLDQYPSVHKVAEVAVPTAAHWSEKYNHFVKEMSQKGYVVFGYLPVVPVDEISNAFKQ 208  black cottonwood
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap