Conserved Protein Domain Family
Calici_MSP

?
pfam05752: Calici_MSP 
Calicivirus minor structural protein
This family consists of minor structural proteins largely from human calicivirus isolates. Human calicivirus causes gastroenteritis. The function of this family is unknown.
Statistics
?
PSSM-Id: 399045
Aligned: 2 rows
Threshold Bit Score: 337.989
Threshold Setting Gi: 81936989
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q672H9   1 MSWLVGALQTFGSLADVAGTVSNIVYQQRQAAQLEKQNELMETWMNKQEALQKSQMELTRDLSINGPAARVQSALDAGFD 80  Sapovirus Hu/Dresden/...
Q672H9   1 MSWLVGALQTFGSLADVAGTVSNIVYQQRQAAQLEKQNELMETWMNKQEALQKSQMELTRDLSINGPAARVQSALDAGFD 80  Sapovirus Hu/Dresden/...
Q672H9  81 EVSARRIAGSGERVIWGNLDRPIMHAGTMDSIRQTRHLDSLSHSLATFKNGTPFGKPAPPTAKSGRPQATTAQITIGHNP 160 Sapovirus Hu/Dresden/...
Q672H9  81 EVSARRIAGSGERVIWGNLDRPIMHAGTMDSIRQTRHLDSLSHSLATFKNGTPFGKPAPPTAKSGRPQATTAQITIGHNP 160 Sapovirus Hu/Dresden/...
Q672H9 161 GSTSV 165 Sapovirus Hu/Dresden/pJG-Sap01/DE
Q672H9 161 GSTSV 165 Sapovirus Hu/Dresden/pJG-Sap01/DE
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap