2M8R


Conserved Protein Domain Family
SNARE

?
pfam05739: SNARE 
SNARE domain
Most if not all vesicular membrane fusion events in eukaryotic cells are believed to be mediated by a conserved fusion machinery, the SNARE [soluble N-ethylmaleimide-sensitive factor (NSF) attachment protein (SNAP) receptors] machinery. The SNARE domain is thought to act as a protein-protein interaction module in the assembly of a SNARE protein complex.
Statistics
?
PSSM-Id: 399038
Aligned: 64 rows
Threshold Bit Score: 30.0743
Threshold Setting Gi: 62901391
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2M8R_A    49 EMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIII 100
O60499   193 IMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLI 244 human
Q9HGN3   169 DLLDTLDNSIETTNSKLRRGMKRLKDFTIASADSKSGCCITVLIIILIALLV 220 Schizosaccharomyces pombe 972h-
EEY57399  68 kMLDDLTDDVDEAQERMNFVMGRLSKLLKTKDKCQLGLILFLVAVLVVMIFL 119 Phytophthora infestans T30-4
O14222   195 VLLDNMNNDADRIERRFDHAKNRLNKVSRKAKQYPRCFIILLLCALLLLVAS 246 Schizosaccharomyces pombe 972h-
Q94KK7   173 RLIDDLDYDVDITDSRLRRVQKSLALMNKSMKSGCSCMSMLLSVLGIVGLAL 224 thale cress
Q9VV76   180 NILDNLANAMDRVETGVQRETQSIGQVNRRDSTWGYWLVIIALFVAIIVVVF 231 fruit fly
Q9Z2Q7   181 EIIDDLANLVENTDEKLRTEARRVTLVDRKSASCGMIMVILLLLVAIVVVAV 232 Norway rat
Q8S4W5   170 RMLDELDQDVDTTHSRLKAAQKKMQELIRKSGSNTQLVLIVVLIVILVLLAT 221 Chlamydomonas reinhardtii
Q946Y7   189 RIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMMICFLLVLFIILFV 240 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap