4RLC


Conserved Protein Domain Family
OprF

?
pfam05736: OprF 
Click on image for an interactive view with Cn3D
OprF membrane domain
This domain represents the presumed membrane spanning region of the OprF proteins. This region is involved in channel formation and is thought to form an 8-stranded beta-barrel.
Statistics
?
PSSM-Id: 399036
Aligned: 4 rows
Threshold Bit Score: 249.752
Threshold Setting Gi: 359759714
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4RLC_A                16 QGQNSVEIEAFGKRYFTDSVRNMKN-ADLYGGSIGYFLTDDVELALSYGEYHDVRGTYETGNKKVHGNLTSLDAIYHFGT 94  Pseudom...
Q9X4S0                25 QGQGAVEGEVFYKKQYNDSVKHVED-GYNPGASLGYFITDDVSVNLTYDKTNYTRSNDGTGSQKLGGDKFGLKGQYHFGT 103 Pseudom...
P37726                25 QGQGAVEGELFYKKQYNDSVKHIED-GFNPGARIGYFLTDDLSLNLSYDKTNHTRSNDGTGSQKIGGDTSSLTAQYHFGQ 103 Pseudom...
rhizoUAM:PSF113_1769  25 QGQGAVEIEGFAKKEQFDSARNFKNnGNLFGGSVGYFLTDDVELRLAYDEVHNAR-TDDGTN--VKGANTALDALYHFNN 101 Pseudom...
4RLC_A                95 PG-VGLRPYVSAGLAHQNITNI-NSDSQGRQQMTMANIGAGLKYYFTENFFAKASLDGQYGLEKRDNghqgEWMAGLGVG 172 Pseudom...
Q9X4S0               104 VG-DAIRPYVEGGVAHGSLTNVaADGHTGRDQSTFLTTGAGAKWYLTDNLYARAGVEADYKLDNGKW----DYAALVGLG 178 Pseudom...
P37726               104 AGvDSLRPYVEGGFGHQSRGNVkADGHSGRDQSTLAIAGAGVKYYFTNNVYARAGVEADYALDNGKW----DYSALVGLG 179 Pseudom...
rhizoUAM:PSF113_1769 102 PG-DMLRPYVSAGFSDQSID---QNGSNGRNRSTFANVGGGAKLYFTENFYARAGVEAQYNIDQGDT----EWAPSVGIG 173 Pseudom...
4RLC_A               173 FNF 175 Pseudomonas aeruginosa
Q9X4S0               179 VNF 181 Pseudomonas fuscovaginae
P37726               180 VNF 182 Pseudomonas fluorescens
rhizoUAM:PSF113_1769 174 VNF 176 Pseudomonas fluorescens F113
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap