2H11,3LCC


Conserved Protein Domain Family
TPMT

?
pfam05724: TPMT 
Thiopurine S-methyltransferase (TPMT)
This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes. Thiopurine S-methyltransferase (TPMT) is a cytosolic enzyme that catalyzes S-methylation of aromatic and heterocyclic sulfhydryl compounds, including anticancer and immunosuppressive thiopurines.
Statistics
?
PSSM-Id: 399030
Aligned: 13 rows
Threshold Bit Score: 198.805
Threshold Setting Gi: 81506546
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H11_A    11 LTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTfLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQ 90 
Q9I011     1 MQADFWHARWANNQIGFHLDEINPYLMRHLSR-LRLQAGEQILVPLCGKTLDLAWLAAQGLEVLGVELSEKAVSDFFEEH 79  Pseudomonas aerugin...
EGH42918   1 MKADFWLQRWSAGQIGFHQSEVNKDLQQYWSS-LNVVPGARVLVPLCGKSQDMSWLSGQGYHVVGAELSEAAVERYFTER 79  Pseudomonas syringa...
Q8PAT3     1 MDTDFWLQRWQDGQTGFHQDEVMPLLQKHWPA-LQLPAHARVLVPLCGKTLDLHWLAAQGHRVLGVEISPLAVTQFFDDA 79  Xanthomonas campest...
Q9BS45    24 LTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTfLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQ 103 human
Q8Y274    13 AAPAFWDERFSRDHMPWDAHGVPPAFRQFCEA---QPAPLSTLIPGCGSAYEAGWLAERGWPVAAIDFAPSAVAS--AQA 87  Ralstonia solanacearum
Q9ZSZ7    32 VNSGGWEKCWVEEVIPWDL-GVPTPLVLHLVK-NNALPNGKGLVPGCGGGYDVVAMANPERFMVGLDISENALKKA-RET 108 Batis maritima
O80562    31 VAEGGWDKCWEDGVTPWDQGRATPLILHLLDS-SALPLG-RTLVPGCGGGHDVVAMASPERFVVGLDISDKALNK----A 104 thale cress
CDY17901  30 VEEGGWEKCWEDGITPWDQGRATPLVVHLVDS--SSLPLGRALVPGCGGGHDVVAMASPERFVVGLDISESALEKAAETY 107 rape
Q9KSN0     2 RDPEFWHNKWAANQIGFHLEDVNPLLIRFWSD-LAPKRSEKVLVPLCGKSEDLIWLANQHDSVQGVELSQIAVRSFFAEH 80  Vibrio cholerae O1 ...
Q93JT2     4 HDNQRWLQLWRERRTDFHQHGVNLLLSRFWPAfAPATPS-RVFVPLCGKSLDMLWLAEQGHDVIGVELSPLAIEAFFREN 82  Pseudomonas stutzer...
Q9Z0T0    19 LTLDDWQDKWVTRHIAFHQEQGHQLLKKHFDTfLKGQSGLRVFFPLCGKAIEMKWFADRGHTVVGVEISEIGIREFFAEQ 98  Norway rat
3LCC_A    31 VEEGGWEKCWEEEITPWDQGRATPLIVHLVDT-SSLPLG-RALVPGCGGGHDVVAMASPERFVVGLDISESALAKANETY 108
2H11_A    91 NLsy-sEEP--ITEIPGTKVfkSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQ- 166
Q9I011    80 DL----HPE--IDQLDGFRR--YRVAGITLLQGDFFALQAEHLAQCRAFYDRAALIALPPEMRERYAGHLQAVLPTRSL- 150 Pseudomonas aerugin...
EGH42918  80 GE----QPH--ITSQGDFKV--YAAPGIEIWCGDFFALTARDIGHCAAFYDRAAMIALPADMRERYVQHLEALMPQACS- 150 Pseudomonas syringa...
Q8PAT3    80 GL----QPQ--RHTSRAGEH--CIAGPIEIICGDAFTLDASVLGDCTAVYDRAALVALPAALRQRYLETVYARLPAGCR- 150 Xanthomonas campest...
Q9BS45   104 NLsy-sEEP--ITEIPGTKVfkSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQ- 179 human
Q8Y274    88 VL----GPHagVVELADFFR---------------FT-PRQPV---QWIYERAFLCAMPRRLWADYATQVARLLPPGGLl 144 Ralstonia solanacearum
Q9ZSZ7   109 FSt---MPN--SSCFSFVKE-------------DVFTWRPEQP--FDFIFDYVFFCAIDPKMRPAWGKAMYELLKPDGE- 167 Batis maritima
O80562   105 NEtygsSPK--AEYFSFVKE-------------DVFTWRPNEL--FDLIFDYVFFCAIEPEMRPAWGKSMHELLKPDGE- 166 thale cress
CDY17901 108 GS----SPK--AKYFTFVKE-------------DFFTWRPNEL--FDLIFDYVVFCAIEPEMRPAWAKSMYELLKPDGE- 165 rape
Q9KSN0    81 FY----TPT--VTRLNAQHEl-YQFDELTLFTGDFFTAPVESV---DLVYDRAALVALPEEMRAEYAQRVLQLLKPGGR- 149 Vibrio cholerae O1 ...
Q93JT2    83 HL-----PP--SKRRQGRFTl-WRHGRIGILCGDYFALSEADLGPVDSVYDRAALTALPPILRSRYVAQLRRIVPDTAR- 153 Pseudomonas stutzer...
Q9Z0T0    99 NLsy-tEEP--LTEIAGAKVfkSSSGNISLYCCSIFDLPRANIGKFDRIWDRGALVAVNPGDRDRYADIILSLLRKGYH- 174 Norway rat
3LCC_A   109 GS----SPK--AEYFSFVKE-------------DVFTWRPTEL--FDLIFDYVFFCAIEPEMRPAWAKSMYELLKPDGE- 166
2H11_A   167 -YLLCVLSYDPTKHP-GPPFYVPH-----AEIERLFG-KICNIRCLEK-VDAFEE--RHKSWGIDCLFEKLYLL-TEK 232
Q9I011   151 -GLLVTIDYPQAEMA-GPPFAVPD-----EEVRGYYA-GGWRIEELER-GDVLGVnwKFLERGVSWLDEAVYLL-ERG 218 Pseudomonas aeruginos...
EGH42918 151 -GLLITLEYDQALLE-GPPFSVPQ-----TWLHRVMS-GNWEVTKVGG-QDTLHSsaRGLKAGLERMDEHVYVL-ERV 218 Pseudomonas syringae ...
Q8PAT3   151 -GLLITLDYPQAEKA-GPPFSVDA-----AEVHALFG-TQWKVQELEH-RDILDQepRFRADGVTALSTGVYRL-QRD 218 Xanthomonas campestri...
Q9BS45   180 -YLLCVLSYDPTKHP-GPPFYVPH-----AEIERLFG-KICNIRRLEK-VDAFEE--RHKSWGIDCLFEKLYLL-TEK 245 human
Q8Y274   145 aGFFVVVDGRAAAPS-GPPFEITA-----QEQEALLS-PA-----FERiADALVP--ENESIPVFAGRERWQVW-RRR 207 Ralstonia solanacearum
Q9ZSZ7   168 ---LITLMYPITNHEgGPPFSVSE-----SEYEKVLVpLGFKQLSLED-YSDLAVepRKG-------KEKLARW-KKM 228 Batis maritima
O80562   167 ---LITLMYPMTDHE-G-------------------G-APYKVALSSY-EDVLVPv-GFKAVSVEENPDSIPTR-KGK 217 thale cress
CDY17901 166 ---LITLMYPITDHD-GGPPY--------------------KVAVSTY-EDVLVPv-GFKA---VSIEENPYSIaTRK 214 rape
Q9KSN0   150 -ILLVSMDYVQTELS-GPPFSVPE-----AEIRTLFM-GC-EVRRVYQdTSIDPHlnKRTQAGLSRFAEEVWVI-EKS 217 Vibrio cholerae O1 bi...
Q93JT2   154 -VFLLTLEDAEADAT------LQQalgvdEELAALYT-AGFEIALAHV-ESLFEPdpQNGA--PRRVEHKVYQL-TGK 219 Pseudomonas stutzeri ...
Q9Z0T0   175 -YLLVVLSYDPTKHT-GPPFYVPD-----AELKKLFG-TKCNMQCLEE-VDALEE--RHKTWGVDYFFEKLYLL-TEK 240 Norway rat
3LCC_A   167 ---LITLMYPITDHV-GGPPY--------------------KVDVSTF-EEVLVPi-GFKAVSVEENPHAIPTR-KGK 217
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap