Conserved Protein Domain Family
Ustilago_mating

?
pfam05722: Ustilago_mating 
Ustilago B locus mating-type protein
This family consists of several Ustilago mating-type proteins. The b locus of the phytopathogenic fungus Ustilago maydis encodes a multiallelic recognition function that controls the ability of the fungus to form a dikaryon and complete the sexual stage of the life cycle. The b locus has at least 25 alleles and any combination of two different alleles, brought together by mating between haploid cells, allows the fungus to cause disease and undergo sexual development within the plant.
Statistics
?
PSSM-Id: 114448
View PSSM: pfam05722
Aligned: 2 rows
Threshold Bit Score: 418.83
Threshold Setting Gi: 287657
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA79218 184 IVRKFARNDRNRMKLLVQAKMLASDPSARAIATQSSLVGNLDDLLRENLGH-LTPADKEEFEDDWNSMISWIKYGVKEKV 262 Ustilago hordei
P22015   185 ILKKFAREDRSRMKHLVRAKLSSSNQSTPPSSTSDSLSNNLDDVLSDNLGRpLTPVDKQQFEDDWASMISWIKYGVKEKV 264 Ustilago maydis 521
CAA79218 263 GDWVYDLVAANKKSpPRTGQARAVTTAANRSPARKTATKTQTKPKKAKQRASKTPSMDST---SALESTPELSACSTADN 339 Ustilago hordei
P22015   265 GDWVYDLCAASKKT-PKPGMPRPVTTVAKRHPARKTKPAAKPKSRTANPRASTTPSIDSTldsSKLESTPELSMCSTADT 343 Ustilago maydis 521
CAA79218 340 SFSSFCSNGSLGQHDPFQQ-YQLQQSPSLNTRGGRKVKALPKRAAQKLPAEalyINNnesgsidtcypvpeerktalsla 418 Ustilago hordei
P22015   344 SFSTFGSSLSMSHYNPFQDgNDILQSPTVKARGNRKVKALPKRAGKQQPDE---VDN----------------------- 397 Ustilago maydis 521
CAA79218 419 sealaqasgqtnsylpaskqqmfppydamGQIPFVprrenlssnSLSAAFG 469 Ustilago hordei
P22015   398 -----------------------------GKIPFL---------CLSVAFV 410 Ustilago maydis 521
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap