Conserved Protein Domain Family
AKAP_110

?
pfam05716: AKAP_110 
A-kinase anchor protein 110 kDa (AKAP 110)
This family consists of several mammalian protein kinase A anchoring protein 3 (PRKA3) or A-kinase anchor protein 110 kDa (AKAP 110) sequences. Agents that increase intracellular cAMP are potent stimulators of sperm motility. Anchoring inhibitor peptides, designed to disrupt the interaction of the cAMP-dependent protein kinase A (PKA) with A kinase-anchoring proteins (AKAPs), are potent inhibitors of sperm motility. PKA anchoring is a key biochemical mechanism controlling motility. AKAP110 shares compartments with both RI and RII isoforms of PKA and may function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction.
Statistics
?
PSSM-Id: 399026
Aligned: 6 rows
Threshold Bit Score: 1245.58
Threshold Setting Gi: 612052327
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_005610910 167 TPNKSLSAVASELVNKTVAACSKNgTSDRVPGSGDRASGLLQSSPNLKYKTTLKIKESsKESKGpDDKPasKKSFFYKEV 246 horse
XP_007503805 181 SPNRTLSKVASELVNETVSLCAKE-TPDKAPGSGDRATPSSRSPPNVKYKSTLKFKET-KECKA-DDKP--KKSFFYKEV 255 gray short-tail...
O77797       173 PPNKSLSKVASELVNETVTACSKNtPSDKAPGSGDRASGTLQSPPNLKYKSTLKIKESnKGGRGpDDRPssKKSFFYKEV 252 cattle
O75969       166 TPTKSLSKIASELVNETVSACSRNaAPDKAPGSGDRVSGSSQSPPNLKYKSTLKIKEStKERQGpDDKPpsKKSFFYKEV 245 human
XP_005334071 165 vPKKSLSTVASELVNETVSACANTtSPDKAPGSGDRASGLSQSPPNLKYKSTLKIKECtKESKCpDDKSasKKSFFYKEV 244 thirteen-lined ...
Q66HC6       167 TPHKSLSTVASELVNETVSACSKNiTGDKAPGSGDRALASSQS-PGLRFTSTLKIKEStKEGKCpDNKPgsKKSFFYKEV 245 Norway rat
XP_005610910 247 FESRNEGDtkeGGRslpaerKMFRGQERPDDFTASVSQGIMTYANSVVSDMMVSIMKTLRIQVKDTTIITILLKKVLIKH 326 horse
XP_007503805 256 FESRNAGD---GGR------KVFGAEPRRDDFTASVSQGIMTYANSVVSDMMVSIMKTLKIQVKDTTIATILLKKVLMRH 326 gray short-tail...
O77797       253 FESRNAGDakeGGRtlpaerKMFRGYERPDDFTASISQGIMTYANSVVSDMMVSIMKTLKIQVKDTTIATIVLKKVLIKH 332 cattle
O75969       246 FESRNGDYareGGRffprerKRFRGQERPDDFTASVSEGIMTYANSVVSDMMVSIMKTLKIQVKDTTIATILLKKVLLKH 325 human
XP_005334071 245 FESRNAGDakeGGKslpgekKMFSGQERPSDFTASVSQGIMTYANSVVSDMMVSIMKTLRIQVKDTTIATILLKKVLIKH 324 thirteen-lined ...
Q66HC6       246 FESRNAGDakeGGRslpgdrKLFRCPDRPDDFSNSISQGIMTYANSVVSDMMVSIMKTLKIQVKDTTIATILLKKVLMKH 325 Norway rat
XP_005610910 327 AKKVVSDLIDSFMKNLHSVTGTLMTDSDFVSAVKRSLFSQGSQKATDIMDAMLGKLYTVIFTKRPPENIRKTKDKAESFS 406 horse
XP_007503805 327 AKEVVSDLIDSFMKNLHNVTGTLMTDTDFVSAVKRSLFSHGSQKATDIMDAMLGKLHSVMLKKSNEPCKKPCKDKSESLS 406 gray short-tail...
O77797       333 AKEVVSDLIDSFMKNLHNVTGTLMTDTDFVSAVKRSFFSHGSQKATDIMDAMLGKLYSVIFAKKPPETVRKTKDKSESYS 412 cattle
O75969       326 AKEVVSDLIDSFLRNLHSVTGTLMTDTQFVSAVKRTVFSHGSQKATDIMDAMLRKLYNVMFAKKVPEHVRKAQDKAESYS 405 human
XP_005334071 325 AKEVVSDLIDSFMKNLHNVTGTLMTDTDFISAVKRSLFSQGSQKATDIMDAMLGKLYTVMFAKKFPDNLRKTKDKSESYS 404 thirteen-lined ...
Q66HC6       326 AKEVVSDLIDSFMKNLHSVTGSLMTDTDFVSAVKRSFFSHGSQKATDIMDAMLGKLYNVMCAKKYPENIRKARDKSESYS 405 Norway rat
XP_005610910 407 LVSMKGM-GDPKNRNVNFATMKSEGKLREKMFCH-ASKPEDEKTCAKTLGEHLIKEGLTLWHKNQQREGKFPSLQQATFA 484 horse
XP_007503805 407 LVSMKGGmNDPRHRGMNYSSMKAEAKLREKPCTPcPSKTDKDKTCAETLGEHIIKEGLTLWHKNHQKETKSPGLQRASFA 486 gray short-tail...
O77797       413 LVSMKGM-GDPKHRNVNFASMKSEGKVRERVCTP-TPKP--EKSCVETLGEHIIKEGLTLWHNSQQKEGISACLQGSPFV 488 cattle
O75969       406 LISMKGM-GDPKNRNVNFA-MKSETKLREKMYS--EPKSE-EETCAKTLGEHIIKEGLTLWHKTQQKECKSLGFQHAAFE 480 human
XP_005334071 405 LLSMKGI-----DRNMNFT-MKSEAKVKEKIYS--SGKSEKEKTCAETLGEHIIKEGLTMWHKTQKKECKSPDFEPAA-- 474 thirteen-lined ...
Q66HC6       406 LISMKSRpGDPKLSNLNFA-MKSESKLKENLFS--ACISEKEKTCAETLGEHIIKEGLNMWHKSQQN---SPGLERAT-- 477 Norway rat
XP_005610910 485 APNE----------QCKPTPESLlgyplDTCNFIp--PMHDPEKLENFMCDSGSWAKDLLISALLLIQYHLAQGGSMDPQ 552 horse
XP_007503805 487 TSSRsvgkpniklpECHPPTTSP-----GPININ---ALSCQERQDNFLYSSDTWAKDLIVSALLLIQYHLAQGGSMDAQ 558 gray short-tail...
O77797       489 TPKR----------QYKPVPDFPlgfpfDPCNFSl--PMQCPEKPENFMCDSDSWAKDLLVSALLLIQYHLAQGGNMDAQ 556 cattle
O75969       481 APNT----------QRKPASDISfeypeDIGNLSl--PPYPPEKPENFMYDSDSWAEDLIVSALLLIQYHLAQGGRRDAR 548 human
XP_005334071 475 -TNK----------QKNPAPDIPfe-clDPCSFSp--SLHFPEIPENFMCDSDSWAKDLIVSALLLIQYHLAQGGRMDAQ 540 thirteen-lined ...
Q66HC6       478 ---K----------QGAVPQEVSfe-cpDPCEVNplqQPQPPENFENFMCESDSWAKDLIVSALLLIQYHLAQGGRMDAQ 543 Norway rat
XP_005610910 553 SFLEAAGSTN--FPINKSPEVSDEPRI---HL-GGDQEEAEKKDLKSVFFNFIQNLLSETIFKSDHSSEVKVPEQPIREG 626 horse
XP_007503805 559 SFLEAAGTTTklAAAPKSNQNSEQSSLgssRL-GGTHEEAEKKDLMSVFFNFIRNLLGETIFKCDDSSEAKAPSHHSKEE 637 gray short-tail...
O77797       557 SFLEAAGTSN--LYPTKSPAVSHESSLrspQV-GADPEEVEKKDLMSVFFNLIRNLLSETIFKSDHSCDPKA----TKED 629 cattle
O75969       549 SFVEAAGTTN--FPANEPPVAPDESCLksaPI-VGDQEQAEKKDLRSVFFNFIRNLLSETIFKRDQSPEPKVPEQPVKED 625 human
XP_005334071 541 SFLEAAGSSN--FPITKTPVVLDESSLktpHV-VCDQEQSEKKDLMSVFFNFIRNLLGETIFKGDNSCESKAPEKSDKEK 617 thirteen-lined ...
Q66HC6       544 SFLEAAASTN--FPTKSSPVVHDEGKVkspPLkICEQEQTEKKDLMSVIFNFIRNLLSETIFKGSRNCESKAHEQIIKEE 621 Norway rat
XP_005610910 627 EGRQCERPVTPSP-------IKLSEDDEA-G--GPFAGLTKMVVNQLDGHMNGQMIEHLTDSVMKLCLIIAKSCDSPLAE 696 horse
XP_007503805 638 EGSFPEVTPPNCP-------PKHCGGYGGgGgtGAIAGLTKMVANQLDGNMNGQMVEQLMDSVMKLCLIIAKSCDTPLGD 710 gray short-tail...
O77797       630 NSPQCERPVTPSP-------AKLNECDET-G--GAFAGLTKMVANKLDGHMNGQMVDHLMDSVMKLCLIIAKSCDSPLAE 699 cattle
O75969       626 R-KLCERPLASSP-------PRLYEDDET-P--GALSGLTKMAVSQIDGHMSGQMVEHLMNSVMKLCVIIAKSCDASLAE 694 human
XP_005334071 618 DCNQGERPMTPSP--------KLSEGDEA----GAFSGLTKMVANQLDGNMNGQMVDHLVDSVMKLCLIIAKSCDSPLAE 685 thirteen-lined ...
Q66HC6       622 EINLCERPLSPCErpmsppvPKFCEDEEAtG--GALSGLTKMVANQLDGCMNGQMVEHLMDSVMKLCLIIAKSCDSPLSE 699 Norway rat
XP_005610910 697 LGDDKSGDASRPTSALPDSLYACLPAKGTETAEALVQNAYQAIHNELRG-SGQPPEECAAPKVIVSNHNLTDTVQNKQLQ 775 horse
XP_007503805 711 LGDEKSGDASRPTSAFPDSFFECLPVKGTGTAEALLQNAYQAIHNELRGmSIHPPEGTNTPKVIVSNHNIADTVQNKQLQ 790 gray short-tail...
O77797       700 LGDDKSGDASRPTSAFPESLYECLSTKGTGTAETLLQNAYQAIHNELRSlSAQPPEGCTAPKVIVSNHNLTDTVQNKQLQ 779 cattle
O75969       695 LGDDKSGDASRLTSAFPDSLYECLPAKGTGSAEAVLQNAYQAIHNEMRGtSGQPPEGCAAPTVIVSNHNLTDTVQNKQLQ 774 human
XP_005334071 686 LGDEKSGDASRPNSAFPESLYECLPVKGTGTAEALLQNAYQAIHNELRCaSGQPPEGCTAPKVIVSNHNLSDTVQNKQLQ 765 thirteen-lined ...
Q66HC6       700 LGDEKCGDASRPSSAFPDNLYECLPVKGTGTAEALLQNAYLAIHNELRGlSGQPPEGCEIPKVIVSNHNLADTVQNKQLQ 779 Norway rat
XP_005610910 776 AVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGRSVGEVLQSVLRYEKERQLDEAVGNVTRLQLLDWLMVNL 854 horse
XP_007503805 791 AVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGRSVGEVLQSVLRYEKERQLDEAVGNVTRLQLLDWLMANL 869 gray short-taile...
O77797       780 AVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVEKGRSVGEVLQSVLRYEKERQLDEAVGNVTRLQLLDWLMVNL 858 cattle
O75969       775 AVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGCSVGEVLQSVLRYEKERQLNEAVGNVTPLQLLDWLMVNL 853 human
XP_005334071 766 AVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGRSVGEVLQSVLRYEKERQLDEAVGNVTRLQLLDWLMVNL 844 thirteen-lined g...
Q66HC6       780 AVLQWVAASELNVPILYFAGDDEGIQEKLLQLSATAVEKGRSVGEVLQSVLRYEKERQLDEAVGNVTRLQLLDWLMANL 858 Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap