1FPZ


Conserved Protein Domain Family
CDKN3

?
pfam05706: CDKN3 
Click on image for an interactive view with Cn3D
Cyclin-dependent kinase inhibitor 3 (CDKN3)
This family consists of cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species. The cyclin-dependent kinase (Cdk)-associated protein phosphatase (KAP) is a human dual specificity protein phosphatase that dephosphorylates Cdk2 on threonine 160 in a cyclin-dependent manner.
Statistics
?
PSSM-Id: 399018
Aligned: 2 rows
Threshold Bit Score: 313.497
Threshold Setting Gi: 81895574
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FPZ_F   1 MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCT 80  human
Q810P3   1 MKPPISIQASEFDSSDEEPVDEEQTPIQISWLPLSRVNCSQFLGLCALPGCKFKDVRRNIQKDTEELKSYGIQDVFVFCT 80  house mouse
1FPZ_F  81 RGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHSYGGLGRSCLvAACLLLYLSD 160 human
Q810P3  81 RGELSKYRVPNLLDLYQQYGIVTHHHPIPDGGTPDIGSCWEIMEELATCLKNNRKTLIHCYGGLGRSCL-AACLLLYLSD 159 house mouse
1FPZ_F 161 TISPEQAI 168 human
Q810P3 160 SISPQQAI 167 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap