5MQF


Conserved Protein Domain Family
BCAS2

?
pfam05700: BCAS2 
Breast carcinoma amplified sequence 2 (BCAS2)
This family consists of several eukaryotic sequences of unknown function. The mammalian members of this family are annotated as breast carcinoma amplified sequence 2 (BCAS2) proteins. BCAS2 is a putative spliceosome associated protein.
Statistics
?
PSSM-Id: 399014
Aligned: 69 rows
Threshold Bit Score: 150.424
Threshold Setting Gi: 346996023
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5MQF_K        13 VDALPYFDQGYeAPGVREAAAALVEEETRRYRPTKNyLSYLTApdYSaf----------eTDIMRNEFERLAARQPIELL 82 
Q22417        24 VDALPYLDTEY-NEADRQLAMKLVEHECKTFRPTKNyLTHLPVpdYDaf----------lTKCMLKEMDRMKKKEEMGKL 92  Caenorhabditis ...
XP_001631672   9 PDALPYYDQGYeEPGVREMVNQLVEEETRRYRPTKNyLDFLPTpnYDvf----------vTPVLKNEFDRISRKQPMDLL 78  starlet sea ane...
XP_003388030  17 VDALPYIDKEYdDPGLKDAALQLIDEETKRYRPTKNyIDYLPVp-rEsf----------eSPLLKIEMDRLASRQPMETL 85  Amphimedon quee...
EDV26629       3 TDALPYFDREYeDAYIKEMVHHLLEEETKRFRPSKKyLENLPPpnDSaf----------vTPIMKKEFERIAANQPMDLL 72  Trichoplax adha...
Q9VAY6         7 VDALPYIDHGYdDVGVRESALAMVEEECRRYRPTKNyLDHLPLpaSSpf----------eTPLMANEFERIQNRLPMETL 76  fruit fly
OWR47754       7 VDALPYIDQGYdDPGVREAALAMVEEECRRYRPTKNyLENAGPepSTaf----------eTAALQREMERVQQRLPMEPL 76  Danaus plexippu...
EGG17705      11 IDSLPYIDAPL-TEDELNMVTNMVQEEMKKFN---------PPnyLEqlgelrtdidqskFQFVGEELKRVELGEKIKPL 80  Cavenderia fasc...
EGC39319      11 IDSLPYVDDEI-TENERIYIQKLIDEEKATFSPPDY-LSQLPQhvDIdyks---------fnfLENDFKRMEENRKMDEF 79  Dictyostelium p...
XP_312666      7 VDALPYIDLGYdDPGVREAAIAMVEEECRRYRPTKNyLEHLPAlnTTaf----------eTELMAAEFERIQNRLPMEPL 76  Anopheles gambi...
5MQF_K        83 SMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVY-NENLVHMIEHAQKELQKLRKHIQ 161
Q22417        93 DMSRCELPAPSAVKGVDRKLWAKVLRNAKAQNEHLLMRQINLELMDEYAAESYLQR-NKVMEDLLTHAEKELRKTKEAVM 171 Caenorhabditis ...
XP_001631672  79 SMKRYELPQPASSQKHDITAWTEAVDNSMAQLEHQAERIINLEILSKYGPSGWRTH-NDLLTRMLEQQQKLLMNIRKQVQ 157 starlet sea ane...
XP_003388030  86 SMKRYELPQPSAAQKNDVGAWQDSVSNSCAQLEHQNERIVNLELLSQYGSNEWRLH-NELMSRMVDRETKELRSLKNQVQ 164 Amphimedon quee...
EDV26629      73 SMKRYELPPPPVTQRNDPHAWKECVDNSSAQLEHQAVRIINLQLLTKYGSNSWRVY-IELLNEMLTNQRKEVQGLTRKIQ 151 Trichoplax adha...
Q9VAY6        77 SMKRYELPPPPSGKLSEVSAWQEAIENSMAQLEHQWVRSLNLELMLDYGTEAWKSY-LEVFTAMQAKAQLQLQQLKKDIQ 155 fruit fly
OWR47754      77 SMKRYELPPPPVGRLGEPTAWAEAVDNSHAQLSHQATRVLNLELQLQYSTEAWRSY-LHVLQALVVKSQNVHAQLRKQIA 155 Danaus plexippu...
EGG17705      81 NLTRYKVEAPQASQKTSKEAWEASVDNAKAQYLHQETRRTNLQLLQRHGGQLWESYlDNDIQNIQDQLTCRLKETKEEIE 160 Cavenderia fasc...
EGC39319      80 DINRYKVTSPTGANikNEKIWNESLNNARSQLEHQDIRKINLELLQRYGANSWKLY-LSDLELLQKILKKQLEQKKAEIE 158 Dictyostelium p...
XP_312666     77 SMKRYELPPPPAGKMNEVSAWSESVDNSMAQLEHQAVRAMNLELMAEYGCEMWKSY-LETLVTMQAKCQARLAEVKKEIQ 155 Anopheles gambi...
5MQF_K       162 DLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQL----ENEIYQIKQQHG 214
Q22417       172 EVHANRKMAQLKAGEKVKQLEQSWVSMVTNNYRMEMENRQIdsdnRKQIKALKLDPT 228 Caenorhabditis elegans
XP_001631672 158 EINWKRKSEQSQAGVQLKQLEQSWVGLVTKNYEIERACLQL----EEEVERLKHTKP 210 starlet sea anemone
XP_003388030 165 EVNWQRKTEQTNVGTQLEELNNHWMTLVYRNFEIERECLKV----QRENEFLKRKAE 217 Amphimedon queenslandica
EDV26629     152 EINWQRKNEQTNCGSELANLEASWFAMVRKNYDIEQACLEL----EAQIDASSKEMG 204 Trichoplax adhaerens
Q9VAY6       156 DVNWQRKQAQTQAGERLRSLEAHWVLLVSKNYEIETECVEL----EKIVHAARQQLR 208 fruit fly
OWR47754     156 AVNWERKRSQTASGARLRALRRRWAQLVADNYRLERALLQL----QQQREKAKGQTT 208 Danaus plexippus plexippus
EGG17705     161 RTNVQRKIEQDQIRSRLVGNQQKWYELVSKNKEIDFACLEL----EKEIDRLQQLKL 213 Cavenderia fasciculata
EGC39319     159 EVNIQRKIKQEDTIEKIRQHENKWLNLVYKNKEIELACQSV----QREIDQLKIQKE 211 Dictyostelium purpureum
XP_312666    156 DVNWARKTKQTQGGEKLRTLEAQWVMLVSKNYEIEQACAKL----EEQIYHKKRQSS 208 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap