1WV2,1TYG,5Z9Y


Conserved Protein Domain Family
ThiG

?
pfam05690: ThiG 
Click on image for an interactive view with Cn3D
Thiazole biosynthesis protein ThiG
This family consists of several bacterial thiazole biosynthesis protein G sequences. ThiG, together with ThiF and ThiH, is proposed to be involved in the synthesis of 4-methyl-5-(b-hydroxyethyl)thiazole (THZ) which is an intermediate in the thiazole production pathway. This family also includes triosephosphate isomerase and pyridoxal 5'-phosphate synthase subunit PdxS.
Statistics
?
PSSM-Id: 399008
Aligned: 23 rows
Threshold Bit Score: 356.167
Threshold Setting Gi: 18266773
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WV2_B  12 VIAGRTYGSRLLVGTGKYKDLDETRRAIEASGAEIVTVAVRRTNIGQnPDEPNLLDVIPPDRYTILPNTAGCYDAVEAVR 91  Pseudomonas aeruginosa
1TYG_A   3 TIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFE-ASQPNFLEQLDLSKYTLLPNTAGASTAEEAVR 81  Bacillus subtilis
Q9KCY6   7 SIGGKTLTSRFFLGTGRYPNPFVQNEVIRVSEAEVLTFAIRRVNLQA-PGEDAILQHLEGKTFTYLPNTSGAKNAEEAIR 85  Bacillus halodurans C...
Q2YP58   3 eFYGKRFESRLLLGTAQYPSPSILADAVRASLSRIVTVSLRRESGEArA-GQDFWALIKALGVAVLPNTAGCHTPREAIT 81  Brucella abortus 2308
Q8UCD2   3 TLYGREVSSRLLLGTARYPSPAVLADAVRASNTDILTISLRREMAGAkKG-GQFFELIRELDRHILPNTAGCHTAKEAVL 81  Agrobacterium fabrum ...
O34293   3 KLYDVEVGSRLLLGTARYPSPAVLAEAVRRAKTEIVTVSLRREAAGGkAG-GAFFELIRELGVRVLPNTAGCHSVQEAVL 81  Rhizobium etli CFN 42
Q8Y372  14 RLYDEVFGSRLLLGTARYPSPQSLEDAVRACGPAMLTVALRRQSAGTpEGGAGFWKMLRALGVPVLPNTAGCYSADEAYT 93  Ralstonia solanacearu...
Q9JXF5   3 tLYGETFPSRLLLGTAAYPTPEILKQSIQTAQPAMITVSLRRAGSGGeAHGQGFWSLLQETGVPVLPNTAGCQSVQEAVT 82  Neisseria meningitidi...
Q9S2N4   7 VLGGTTYASRLIMGTGGAPSLDVLERALVASGTELTTVAMRRVNASV---HGSVLSVLERLGIRVLPNTAGCFTAGEAVL 83  Streptomyces coelicol...
5Z9Y_B   7 vIGDRSFASRLIMGTGGATNLAVLEQALIASGTELTTVAIRRVDADG---GTGLLDLLNRLGITPLPNTAGSRSAAEAVL 83  Mycobacterium tubercu...
1WV2_B  92 TCRLARELLdGHNLVKLEVLADQKTLFPNVVETLKAAEQLVKDGFDVMVYTSDDPIIARQLAEIGCIAVMPLAGLIGSGL 171 Pseudomonas aeruginosa
1TYG_A  82 IARLAKASG-LCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQ 160 Bacillus subtilis
Q9KCY6  86 IARLARASG-LSDWIKVEISVNERTLLPDPVETLRATETLANEGFTVLPYTSDDPVLCKRLEEAGAAAVMPGGAPIGTGL 164 Bacillus halodurans C...
Q2YP58  82 TAHMAREVF-GTNWIKLEVIGDTDTLQPDPFGLVEAARILCDEGFEVFPYMNDDLIVAERLIEAGCKVLMPWGAPIGSGR 160 Brucella abortus 2308
Q8UCD2  82 TAKMAREVF-RTDWIKLEVIGHHDTLQPDVFALVEAAKILCDEGFEVFPYTTDDLVVAEKLLEAGCRVLMPWCAPIGSAM 160 Agrobacterium fabrum ...
O34293  82 TAKLARDVF-RTDWIKLEVIGHHDTLQPDVFGLVEAARILSGEGFQVFPYTTDDLVVAEKLLDAGCRVLMPWCAPIGSAM 160 Rhizobium etli CFN 42
Q8Y372  94 LAQMSREVF-ETDWIKLEVIGDDYTLQPDTLALPAAAERLIRDGFKVLPYCTEDLVLCRRLLDVGCRALMPWAAPIGTGR 172 Ralstonia solanacearu...
Q9JXF5  83 TAQMAREVF-ETDWIKLELIGDDDTLQPDVFQLVEAAEILIKDGFKVLPYCTEDLIACRRLLDAGCQALMPWAAPIGTGL 161 Neisseria meningitidi...
Q9S2N4  84 TARLAREAL-GTDLVKLEVIADERTLLPDPVELLDAAETLVDDGFTVLPYTNDDPVLARKLEDAGCAAIMPLGSPIGSGL 162 Streptomyces coelicol...
5Z9Y_B  84 TAQLAREAL-NTNWVKLEVIADERTLWPDAVELVRAAEQLVDDGFVVLPYTTDDPVLARRLEDTGCAAVMPLGSPIGTGL 162 Mycobacterium tubercu...
1WV2_B 172 GICNPYNLRIILEEA-KVPVLVDAGVGTASDAAIAMELGCEAVLMNTAIAHAKDPVMMAEAMKHAIVAGRLAYLAGRMPR 250 Pseudomonas aeruginosa
1TYG_A 161 GILNPLNLSFIIEQA-KVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPL 239 Bacillus subtilis
Q9KCY6 165 GILNPYNLGLIVEEA-NVPIIVDAGLGSAQDVVQAMELGADGVLMNTPVAKAKDPVKMALAMKHAIEAGRLSYLAGRIPK 243 Bacillus halodurans C...
Q2YP58 161 GLNNPYALKTMRAHFpDIPLVVDAGIGVPSHAAAAMELGFDAVLINTAVAKAGDPAAMARAFALAVEAGRLAYEADPIEA 240 Brucella abortus 2308
Q8UCD2 161 GPLNLTALKSMRARFpEVPLIVDAGIGRPSHAVTVMELGYDAVLLNTAVAGAGDPVGMAEAFARAIEAGHQAYLSGPLEP 240 Agrobacterium fabrum ...
O34293 161 GPVNPMALRAFRAHFpDVPLIVDAGVGRPSHAAAVMEYGYDAVLLNTAVAGAGDPAAMAEAFALAIDAGRIAHSAVPLEP 240 Rhizobium etli CFN 42
Q8Y372 173 GPTNPYGLRLLRERLpDVPLIVDAGLGVPSHATQVMEWGYDGVLLNTAVAQAGDPVAMARAFAMATQAGRLARLSGPMPE 252 Ralstonia solanacearu...
Q9JXF5 162 GAVHAYALNVLRERLpDTPLIIDAGLGLPSQAAQVMEWGFDGVLLNTAVSRSGDPVNMARAFALAVESGRLAFEAGPVEA 241 Neisseria meningitidi...
Q9S2N4 163 GIRNPHNFQLIVEHA-RVPVILDAGAGTASDVALAMELGCAGVMLASAVTRAQEPVLMAAAMRAGVEAGRLARRAGRIPR 241 Streptomyces coelicol...
5Z9Y_B 163 GIANPHNIEMIVAGA-RVPVVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAAAMAAAVTAGYLARCAGRIPK 241 Mycobacterium tubercu...
1WV2_B 251 KLYASASSP 259 Pseudomonas aeruginosa
1TYG_A 240 KQYGTASSP 248 Bacillus subtilis
Q9KCY6 244 KRYATASSG 252 Bacillus halodurans C-125
Q2YP58 241 RDMASPSTP 249 Brucella abortus 2308
Q8UCD2 241 RDMAVPSTP 249 Agrobacterium fabrum str. C58
O34293 241 RDMAVPSTP 249 Rhizobium etli CFN 42
Q8Y372 253 RDVAQASTP 261 Ralstonia solanacearum GMI1000
Q9JXF5 242 RDKAQASTP 250 Neisseria meningitidis MC58
Q9S2N4 242 RHFAEASSP 250 Streptomyces coelicolor A3(2)
5Z9Y_B 242 RFWAQASSP 250 Mycobacterium tuberculosis H37Rv
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap