6GCS


Conserved Protein Domain Family
NDUF_B7

?
pfam05676: NDUF_B7 
Click on image for an interactive view with Cn3D
NADH-ubiquinone oxidoreductase B18 subunit (NDUFB7)
This family consists of several NADH-ubiquinone oxidoreductase B18 subunit proteins from different eukaryotic organisms. Oxidative phosphorylation is the well-characterized process in which ATP, the principal carrier of chemical energy of individual cells, is produced due to a mitochondrial proton gradient formed by the transfer of electrons from NADH and FADH2 to molecular oxygen. The oxidative phosphorylation (OXPHOS) system is located in the mitochondrial inner membrane and consists of five multi-subunit enzyme complexes and two small electron carriers: coenzyme Q10 and cytochrome C. At least 70 structural proteins involved in the formation of the whole OXPHOS system are encoded by nuclear genes, whereas 13 structural proteins are encoded by the mitochondrial genome. Deficiency of NADH ubiquinone oxidoreductase, the first enzyme complex of the mitochondrial respiratory chain, is one of the most frequent causes of human mitochondrial encephalomyopathies.
Statistics
?
PSSM-Id: 398999
Aligned: 72 rows
Threshold Bit Score: 62.2031
Threshold Setting Gi: 354544036
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6GCS_8         8 LSQEDMKKHKILLAYRDRCAALLVPLNECRKKNYY-MPWACGHERHEYEMCEVADFQRRVK 67  Yarrowia lipolytica
XP_012058985  41 LSEEDMMAFKIPYDRRDYCAHKYMELHECKRRHYP-FMLKCAHERHQYNECYVEDYVIRMK 100 Atta cephalotes
XP_002123568  37 ATSEEMDKAALRREERDYCAHMFMDIMKCRREWFP-ELYNCRPLIEKYQHCTVNDIKHRML 96  vase tunicate
XP_018645208  40 LTEEEMIAAGLKPYERDYCAHLLLAFRKCGDEHVI-PALYCSDLKHKYRHCKESDLLHRMK 99  Schistosoma mansoni
KRY39591      44 ATDEEMDAWQLEYRDRDYCAHFYINHRRCLDNNRPfAYWNCKHERHELTKCEWEDMVMRVK 104 Trichinella spiralis
XP_002424531 682 ITEEEMDALKIPPEERDYCTHFLRDYYDCIYNKRP-LNFLCNREKHAYKHCRQEDFYLQMK 741 human body louse
CCE40758      14 PSQQELDDHNVPFYYRDKCASNLIEYYKCLDKGTS----FCNKTKDEFYKCQYYLLKGRLD 70  Candida parapsilosis
CAR65779      10 LSEEDLQKYKVPLRWRDRCAANFALYHICLKRQSAnSSVDCKHDKHVWEECENLDFIRRQK 70  Debaryomyces hansenii CBS767
EGV60372      10 lSDDDLQKYKVPLKWRDRCAFYFALYQTCLIRQSAnGSVDCGHDKHAWEECENLDLIRRKQ 70  Yamadazyma tenuis ATCC 10573
NP_492119     44 ATWEEMEQWKLKPAQRDYCAHHLISLMKCQTQNAPfAGHACDGERGAWDKCEYDDHIMRIK 104 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap