Conserved Protein Domain Family
AvrD

?
pfam05655: AvrD 
Pseudomonas avirulence D protein (AvrD)
This family consists of several avirulence D (AvrD) proteins primarily found in Pseudomonas syringae.
Statistics
?
PSSM-Id: 398985
Aligned: 5 rows
Threshold Bit Score: 457.38
Threshold Setting Gi: 407311566
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015659339      8 LLDSVDDYLGPGEKRFFGSGFRRVQYRYDKVELTGGRDAPTELGSR--LDvvYPADWSRKaKTrGDLRPHLSTVDGLIIA 85  Streptomyces...
WP_011039533     12 FHRSVDDVLGPRERRFFGEGFKRAEHRLRHIFVTYGPEGRAQADARvsVD--YPSDWSRK-GD-ADQRPHLSTVDVLVIG 87  Streptomyces...
Q096X9           16 RYSSIDEVLGDSRGRFFGAGFRQVRQNVLDIRI-----DAPAKTVRatANilYPSTWSKKnRA---LTPHLSSIDAFTIG 87  Stigmatella ...
UANL:O3I_037600   4 SFSSYDEPLGPHTSRYFGDGYKNVGREFTRLALSRSNQLGAKHSGRarLT--YPAGWSTK-RD-GELIPHVSSVDTVMLA 79  Nocardia bra...
Q5YPQ9            4 SFSSYDEPLGPRATRYFGEGYRKVGPELTDLRLGNSARPGAKHAAMarLE--YPAAWSTK-KH-RELVPHVSSVDTVMLA 79  Nocardia far...
WP_015659339     86 VHLSEAALTHALGLGPESRRAGRVLSVRIKAGSQP-DEELTGLPVRTTVLGV-PVPEGEDEAVSRLQTMVGAMRVRTDLR 163 Streptomyces...
WP_011039533     88 AQLSEVHLAHVLGLSPDQRARAVLQRVRIKAGRSPvEEDLAGFAASAQLVATiPSDRVVGLFLSTVECVVGTLRMRCEIR 167 Streptomyces...
Q096X9           88 VQLCEMYLRETCGIEALTARRMWLRRCVLKAGSTP-TLDLAEVPAHCTLTKTeRSEDSLCGYLSSFTGRIGSMGLEFVID 166 Stigmatella ...
UANL:O3I_037600  80 AALCDAAVARSRELSAAESARSWVRHATVRAGASP-HEDLADVPVTAEVVGAsDTTES--EIETTFKFQVGPLNGTLSIV 156 Nocardia bra...
Q5YPQ9           80 TALCDAAVTRARGLRPEEAARMWVSHGTVRAGAAP-HEDLDHIPVQAEITAV---TEEASEAETTFKFTVGNLAGTLTLV 155 Nocardia far...
WP_015659339    164 HPLpadtSRNPVATAAYSCPAELLGPVERQYYGTGFAARTQSVRKVAVRVAEAHASAVVDVaQEPGSVLATEGTEGLYQP 243 Streptomyces...
WP_011039533    168 HEA----GVPHQAAGSYDSLRGLLGDPRLRLFGEGFTSRRQLVEDVVIDPQARQAAAAVRViRDEDAPSPATGLEGAHHD 243 Streptomyces...
Q096X9          167 HPIi---TARDGVAAQYDNATDLLGPSEQHYYGSAYTETDVLLQDVELDLVANSARARLGL-EHPSQRPNLQGMGAAYFP 242 Stigmatella ...
UANL:O3I_037600 157 HPPgs-gAQSEPGLDEFGGLAEIFGPAP-HYYLNGLVNHTLTASELTVDETGTRITGQHRI--TPGQVGGFAGAESAYSY 232 Nocardia bra...
Q5YPQ9          156 HPLgtgsAEPGEQIDHLDSLADLYGPAP-HYYLTGVKDHTLTATDLIVDDDATRITSRQTV--RPGAEGGYVGAESAYWN 232 Nocardia far...
WP_015659339    244 FVGLIDTFVTSLQLGQILLYETDGISRGASNTLWMRTTVFQASAEPEPIRYETPLDVRLE----NSTLLRRDEETWRAAD 319 Streptomyces...
WP_011039533    244 RASAIDAFVIGLQLGQVLLYTLDEVPRAQSNTLWMRETILELDPLRPPLPATAPVTTRLDr---CKRLETGKGDIWRSAD 320 Streptomyces...
Q096X9          243 FVSGLNGIVSVAQLAQALMYRSDDIAREVSNNLWMRKITIS-----SPIPVTPSRTMRVEtwcnKTSLLPIKDTLWRSSS 317 Stigmatella ...
UANL:O3I_037600 233 SSSPIDSVVGAAQSSQILLYHLDSLTRANSNTLWMRK--LEFITAGPHRPIDDSFEGILEi--rRASIIDRGGSRWRSAD 308 Nocardia bra...
Q5YPQ9          233 SVSPIDAIVGAAQLSQILLYRMDSLDRTNSDTLWMRK--LEFFCEPPHRSSATDFDGTVEi--rRTSTIDRGGQRWRSAD 308 Nocardia far...
WP_015659339    320 I-VGRLAGNTVRCSVAHRL 337 Streptomyces davaonensis
WP_011039533    321 I-VGEFLGVRLRCSVAHRL 338 Streptomyces coelicolor
Q096X9          318 F-VVILPGIYGEYSLAHQL 335 Stigmatella aurantiaca DW4/3-1
UANL:O3I_037600 309 IqIKAFNGVTGSCLLAHQL 327 Nocardia brasiliensis ATCC 700358
Q5YPQ9          309 LlIKEFQGVTGSCLLAHRL 327 Nocardia farcinica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap