Conserved Protein Domain Family
Mg_trans_NIPA

?
pfam05653: Mg_trans_NIPA 
Magnesium transporter NIPA
NIPA (nonimprinted in Prader-Willi/Angelman syndrome) is a family of integral membrane proteins which function as magnesium transporters.
Statistics
?
PSSM-Id: 398984
Aligned: 5 rows
Threshold Bit Score: 387.97
Threshold Setting Gi: 81902337
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9VK62  43 TDFYIGVGLAISSCFFIGSSFIIKKKALIRLSRYGEVRASAGGFGYLREWIWWAGLLTMGVGEAANFAAYAFAPASLVTP 122 fruit fly
Q8N8Q9   8 YDFYIGLGLAMSSSIFIGGSFILKKKGLLRLARKGSMRAGQGGHAYLKEWLWWAGLLSMGAGEVANFAAYAFAPATLVTP 87  human
Q91WC7  45 QIHLFGVLLAILGNLVISISLNIQKYSHLHLAQKEHPKP------YFKSVLWLSGVLLTALGETGNFAAYGVAPITLIAP 118 house mouse
B3LFA3   6 pDNIHGVILAVSSSIFIGSSFIIKKKGLKKAGVSG-ARAGEGGYGYLYEPWWWAGMITMIVGEIANFAAYAFAPAILVTP 84  thale cress
Q8GWX2   3 TDNGKGLILAVASSVFIGSSFILKKKGLKRAGAIG-TRAGYGGYTYLLEPLWWAGMVTMIVGEAANFVAYIYAPAVLVTP 81  thale cress
Q9VK62 123 LGALSVIISAVMASRFLNEKLNLLGKIGCFLCILGSTIIVIHSPKEKEIEDLQLLFDMLLDPVFILYVICIVGSTVFVAC 202 fruit fly
Q8N8Q9  88 LGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIF 167 human
Q91WC7 119 LGCMSVTGSAIISVLFLKENLRASDLLGMTLAFAGTYLLVNFAPNITQAISARTVQYYFVGWQFLVYVILEI-LVFCILL 197 house mouse
B3LFA3  85 LGALSIIFSAVLAHFILEEKLHMFGILGCVLCVVGSTTIVLHAPHEQGIESVKQVWHLATEPGFLAYSAVVLVVVLALIF 164 thale cress
Q8GWX2  82 LGALSIIISAVLAHFLLKEKLKKMGVLGCVSCIVGSVVIVIHAPKEQTPNSVEEIWNLATQPAFLIYVAITMSIVLALIL 161 thale cress
Q9VK62 203 FIAPRHGHTNVVVYIFLCSGIGSLTVMSCKALGLAIRQTLnNGGNVFLTWMPWFLILVTVTFIAIQMNYLNKALDIFNTS 282 fruit fly
Q8N8Q9 168 VVGPRHGQTNILVYITICSVIGAFSVSCVKGLGIAIKELF-AGKPVLRHPLAWILLLSLIVCVSTQINYLNRALDIFNTS 246 human
Q91WC7 198 YFHKRKGMKHIVVLLTLVALLASLTVISVKAVSGMITLSV-TGKMQLTYAIFYIMLVIMIASCVFQVKFLNQATELYTMT 276 house mouse
B3LFA3 165 YYEPRYGKTHMIVYVGICSLMGSLTVMSVKAVAIAIKLTF-SGMNQFKYFHAWIFIIVVTICCILQINYLNKALDNFNTA 243 thale cress
Q8GWX2 162 HFEPLCGQTNILVYIGICSLMGALTVMSIKAIGIAIKLTM-EGVSQIGYPQTWLFVMVAVTCVVTQLIYLNKALDTFNAA 240 thale cress
Q9VK62 283 IVTPVYYVMFTTLVIAASAILFKEFTHMRFDDILGDVCGFLIVITAVFLLNAFRDI 338 fruit fly
Q8N8Q9 247 IVTPIYYVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTIIVGIFLLHAFKDV 302 human
Q91WC7 277 TVVPVNHVFFTTSAIIAGIIFYQEFLGAAFLTVFIYLFGCFLSFLGVFLVTRNREK 332 house mouse
B3LFA3 244 VISPVYYVMFTTFTILASMIMFKDWASQSGLQIATELCGFVTILSGTFLLHKTKDM 299 thale cress
Q8GWX2 241 IVSPVYYVMFTTLTIVASAIMFKDWSGQDAASVASELCGFITVLTGTMILHGTREe 296 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap