Conserved Protein Domain Family
Diacid_rec

?
pfam05651: Diacid_rec 
Putative sugar diacid recognition
This region is found in several proteins characterized as carbohydrate diacid regulators. An HTH DNA-binding motif is found at the C-terminus of these proteins suggesting that this region includes the sugar recognition region.
Statistics
?
PSSM-Id: 398982
Aligned: 106 rows
Threshold Bit Score: 107.931
Threshold Setting Gi: 493768061
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Desaci_3506   5 LSTNIAQNIVELVYQTSGFHAIVCDATGTIIAD--SANKRIEVKHRGSQEILSSDrNYIEITEEEEIASsgQMKEGYNGA 82  Desulfosporo...
Q0SH42            2 LSEALAQQIANEITDVIGFNVLITDAAGTVVGS--GDERRIGQFHEASIEVIRAR-RMIAHSAADVRDLv-GSLPGVTIP 77  Rhodococcus ...
BGI:SBI_00913    18 LSPSLAQEIAGDTSAVIGLNVLITDSEGVVIGS--GDSSRIGTFHEASVEVMRTQ-EAAIHTATQAQELk-GVRAGVTLP 93  Streptomyces...
CDA91298          1 mlKYVAEEIASITMRVTGYPIIITDKKAVIIGAdkDNIDRLNDIHEASIEVMASG-MKKKHGPAECRKLr-GTYPGITMP 78  Firmicutes b...
WP_013047764      1 mlEKIAQKIASSTAELINIDLIITDEKGIIIGA--SDPSRKGSLHEPSLEAIQTG-KISIQRENEVTHLt-GVKPGVTLP 76  Aminobacteri...
EFQ24711          1 mlREVAQEIAESASGIIGHGVILTDERGVVIGA--SDPSRLGQRHGPSLDCLQSG-RLEVTDEAQARER--EVLPGVTVP 75  Aminomonas p...
WP_014807082      1 mlNQVAQDIAVTVSDIIGHGVLVTDGRGIIIGC--DDASRIGVCHTPSLEVMKSR-KPLVTTEAEASKMs-GVKPGFTLP 76  Acetomicrobi...
WP_014163343      1 mlERFAQIICETTWKIIGYEVIITDPKAVIIGS--SNPERIGTIHQPSIEAMKLK-QEIFTDEIEATNWp-GVKPGVTLP 76  Thermovirga ...
EHM12468         11 vlsgCAQEIARSTAGIVGYDVIITDMKGIIIGA--SRAERLGCHHEASDEVIRTG-HSSATSAEVAATMs-GTLPGVTHP 86  Jonquetella ...
WP_002839811      3 iSDHTAKMIVEKLKDVIDYDLNFFDQEGYIIYS--TNSKRIGTYHEAAKECVVQN-KTIFVDNEREYV---GAKKGINIP 76  Finegoldia m...
jgi:Desaci_3506  83 IE-SQGIKIGTFGIAGRLEIVRPVAKVAVGMIVLLIKDEELKEVIRDQVQILSSAV 137 Desulfosporosinus acidiphilus SJ4
Q0SH42           78 LV-IDGDVVGTIGLSGSPEQVEQFGLVVKRQTEILMQEASRIGTRLTYERAAEELL 132 Rhodococcus jostii RHA1
BGI:SBI_00913    94 LV-MDGHAVGTVGITGTPAQVRRFGLVVKRQTEILLRESAVLRSRVVRERVLEDLL 148 Streptomyces bingchenggensis BCW-1
CDA91298         79 IA-IHDEVVGSIGIRGDSEEVEKYGMLVKMVAEIMLKDRIEAESAHIRHSNLQMLa 133 Firmicutes bacterium CAG:238
WP_013047764     77 IE-FTGKRIGTIALTGSPARVTQFGLLVKKHTELILSEKLFSEVFFIRSRAIQTLM 131 Aminobacterium colombiense
EFQ24711         76 VS-VAGRYVGTLAISGPPGEVARYGRLVQSQAEILLREQALTESTLLREQALRDLV 130 Aminomonas paucivorans DSM 12260
WP_014807082     77 IL-LAEEVVGSIAIAGDPDEVKKFGLLVQKQAEIMLRQQALMQQNMLRERALSDLA 131 Acetomicrobium mobile
WP_014163343     77 IS-LGGEVVGSIAIAGNHKEVAKYGHLVQKHAEIFLHEQVLTESSLARERALSDLV 131 Thermovirga lienii
EHM12468         87 IAsLNGTVVGTMAITGEPEAVQPFALIVRKQIEILLREQERFALTVNRESSLQDLV 142 Jonquetella anthropi DSM 22815
WP_002839811     77 VT-IDGEIIAVIGITGNKDEVMKYGNIIKKMTEILVKEQLVEKNRLKKKDMNKYLF 131 Finegoldia magna
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap