Conserved Protein Domain Family
NKAIN

?
pfam05640: NKAIN 
Na,K-Atpase Interacting protein
NKAIN (Na,K-Atpase INteracting) proteins are a family of evolutionary conserved transmembrane proteins that localize to neurons, that are critical for neuronal function, and that interact with the beta subunits, beta1 in vertebrates and beta in Drosophila, of Na,K-ATPase. NKAINs have highly conserved trans-membrane domains but otherwise no other characterized domains. NKAINs may function as subunits of pore or channel structures in neurons or they may affect the function of other membrane proteins. They are likely to function within the membrane bilayer.
Statistics
?
PSSM-Id: 398973
Aligned: 7 rows
Threshold Bit Score: 317.868
Threshold Setting Gi: 229288473
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_019201733  10 LAFICGMQL-VSVLERQVIDFLGYQWAPILTNFLHIIVVILGLFGTIQFRPRYVTGYAAWLVVWMTWNVFIICFYLEVGD 88  Nile tilapia
XP_005058423  10 LVGFCCLQL-VAALERQIFDFLGYQWAPILANFLHIMAVILGIFGTIQYRSRYLMMYAVWLVLWVGWNAFIICFYLEVGR 88  Collared flycat...
XP_015220480  10 LIFLCTFQL-LAALERQVFDFLGYQWAPILCNFFHIIIVILGLFGTIQYRPRYIIVYAIWAALWVTWNVFIICFYLEVGG 88  spotted gar
EEN59168      10 LIALCFLQL-IATVERQVFDFLGYMWAPIIGNFFQIICVILGLFGTYQYRPRYIVVYCTWGVLWVAWNIFIICVYLELGS 88  Florida lancelet
XP_001237136   8 LLFFFFSPPqLFVIERQVFDFLGYMWAPILVNFFQILFVIFGFFGAYQYRPRYLVAYTVWSLLWLGWNIFLVCFYLNIGI 87  Anopheles gambi...
XP_008215096  10 LLTICTLQL-ITTIERQVFDFLGFMWVPILVNFFNIIFVILGFFGAFQYRPKYIISYCVWNVLWLGWNIFLTCFYLSAGV 88  jewel wasp
XP_025757336   9 tlifictlqlVLALERQVFDFLGYQWAPILANFFHIIIVILGLFGTIQYRPRYIVVYTVWAAIWVAWNVFVICFYLEVGG 88  Nile tilapia
XP_019201733  89 LSR--DSDLvLTFNLSMHRSWWMENGPGCRVTPITp-PPS---WAPEDHRYISISGCLMDFQFIEVAHSSLQILLALVGF 162 Nile tilapia
XP_005058423  89 LSQ--DRDFiMTFNTSLHRSWWMENGPGCLVTPVL--NSK---LAPEDHHVITVSGCLLDYQYIEVVSSATQIFLALFGF 161 Collared flycat...
XP_015220480  89 LSK--ESDL-LTFNISAHHSWWSEHGPGCVRKEMPa-TGV---KSFDSQSYISVMGCMVEYQYIEVMHSAFQILIALVGF 161 spotted gar
EEN59168      89 LTV--ETPA-LTLGAPQSISWWREHGIGCQAS-----------NATATSTNPVVTGCLLDFTYVEMIHAAIQIVLAIVGF 154 Florida lancelet
XP_001237136  88 LDRvsDSDL-LNLGTG-SVSWFEENGYGCRPTYPTniTSE---DPYRPVRPERVDGCLLEYHIVEVVQSGIHCALAVFGI 162 Anopheles gambi...
XP_008215096  89 LDK--NSDL-LNLGTG-SFSWWHVNGPGCKPDHn--kTGPdqlDVYRPVRPDRVTGCVLDYEVIEILHSSTQCLLAVMAV 162 jewel wasp
XP_025757336  89 LSK--DSDL-LTFNISAHHSWWSEHGPGCVRREMPqaPGV---HTTESHSYITVMGCFMDYQYIEVMHSGAQILVALLGF 162 Nile tilapia
XP_019201733 163 IYACYVVKLISEEEDSFDFIGGFDSYG-YQGPQKTSHLQLQPMYMS 207 Nile tilapia
XP_005058423 162 VYACYVSKVFLEEEDSFDFIGGFDSYG-YQAPQKTSHLQLQPLYTS 206 Collared flycatcher
XP_015220480 162 VYACYVVSAFTEEEDSFDFIGGFDPFPlYHVNEKPSHLLLKPMYLS 207 spotted gar
EEN59168     155 IYGIYVVYMFTEEDDSFDFIGGFDSYSaYQAPQKTSHMQLQPMYv- 199 Florida lancelet
XP_001237136 163 FGAICLGQTFLDEDDSFDFMGG-DA-------KSPQHTAVHPMYVS 200 Anopheles gambiae str. PEST
XP_008215096 163 IGGICLSRVFMEEDDSFDFVGGGDF-------GMAGHTPLHPMYVS 201 jewel wasp
XP_025757336 163 VYACYVVSAITEEEDSFDFIGGFDPFPlYHVNEKSSHLLLKPMYPS 208 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap