Conserved Protein Domain Family
DUF782

?
pfam05614: DUF782 
Circovirus protein of unknown function (DUF782)
This family consists of porcine and bovine circovirus proteins of unknown function.
Statistics
?
PSSM-Id: 114342
View PSSM: pfam05614
Aligned: 2 rows
Threshold Bit Score: 195.333
Threshold Setting Gi: 81982029
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O56124   1 MVTIPPLVSRWFPVCGFRVCKISSPFAFTTPRWPHNDVYIGLPITLLHFPAHFQKFSQPAEISDKRYRVLLCNGHQTPAL 80  Porcine circovirus 2
Q9YQT1   1 MVTIPPLVSRWFPVCGFRVCKISSPFAFATPRWPHNDVYIRLPITLLHFPAHFQKFSQPAEISDKRYRVLLCNGHQTPAL 80  Porcine circovirus ty...
O56124  81 QQGTHSSRQVTPLSLRSRSSTFNK 104 Porcine circovirus 2
Q9YQT1  81 KQGTHSGRQVTPLSLRSRSSTFHQ 104 Porcine circovirus type 2-D
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap