Conserved Protein Domain Family
CLPTM1

?
pfam05602: CLPTM1 
Cleft lip and palate transmembrane protein 1 (CLPTM1)
This family consists of several eukaryotic cleft lip and palate transmembrane protein 1 sequences. Cleft lip with or without cleft palate is a common birth defect that is genetically complex. The nonsyndromic forms have been studied genetically using linkage and candidate-gene association studies with only partial success in defining the loci responsible for orofacial clefting. CLPTM1 encodes a transmembrane protein and has strong homology to two Caenorhabditis elegans genes, suggesting that CLPTM1 may belong to a new gene family. This family also contains the human cisplatin resistance related protein CRR9p which is associated with CDDP-induced apoptosis.
Statistics
?
PSSM-Id: 398952
Aligned: 129 rows
Threshold Bit Score: 344.523
Threshold Setting Gi: 74778645
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBN75944      39 AQLFIKLAVLYMSFMFFSkqFQTHqikeavaimkeseqdevsqvlkplpkgeesdvnWMKEAMGlQSSRIPQfpeydarg 118 Ectocarpus sili...
Q96KA5         9 TSLVVGVFVVYVVHTCWV--MYGI---------------------------------VYTRPCS----GDAN-------- 41  human
3_pfamImport   1 AKLLLGVFVVYALHTAWL--LYGF---------------------------------LHTKPCD-----GSS-------- 32 
XP_013126123   8 TTLIVGVFVVYVLHTCWV--MYGI---------------------------------VYTKPCS--NPKGAN-------- 42  Nile tilapia
Q6DHU1         8 TSLIVGVFLLYVLHTCWV--MYGI---------------------------------VYTKPCE--KRRAES-------- 42  zebrafish
CAP25397       7 TKIVSTVFLSFMFYNFFQ--LYKL---------------------------------FTPELCA-DTDPDSN-------- 42  Caenorhabditis ...
KRY29656       7 LDILSGIFLLYAAYCVYV--FSEI---------------------------------LFPEKCVpKPGSRRP-------- 43  Trichinella spi...
EDV25935       7 GRATVVVFLSYMVYNFYA--LYLL---------------------------------FYPQQCSiVAKNENN-------- 43  Trichoplax adha...
XP_015212343  19 TTLIVGVFVVYVLHTCWV--MYGI---------------------------------VYTKPCE-----KIQ-------- 50  spotted gar
XP_023186791  20 AKLLLGVFVVYMLHTAWL--LYGF---------------------------------LNTKPCD--GGRGEP-------- 54  southern platyfish
CBN75944     119 rqlsVHRCT---F---NRG--QKVDLHVYMS--GsEDEasvwetqgEEAGergagpegeegTANslpaRLLWHESNL-VF 187 Ectocarpus sili...
Q96KA5        42 -------CIqpyL---ARR--PKLQLSVYTT--TrSHLg------aENNI------------------DLVLNVEDFdVE 83  human
3_pfamImport  33 ----GEHCItsyL---TAR--ARLQMSVFTC--L-VPD--------NSQL------------------HLAVKIDPFdPD 74 
XP_013126123  43 -------CItpfL---AGN--PKLQLSIYTA--LrSNA--------EGGH------------------TLIHKEENFdVN 82  Nile tilapia
Q6DHU1        43 -------CIspyL---AAK--PRLQLSVYT-----ALR--------PNAd-----------GGH----SLIHREEEFdVN 82  zebrafish
CAP25397      43 -------CYspiIrpnSEGlfDLLQLRVYFS----TKRd----------------------SLE----TLVTTVENVqIA 85  Caenorhabditis ...
KRY29656      44 ----SLACLrseL---EADqyHNLQLRVYTS--L-SKRn-------SKLI------------------SEVLRIENFsMN 88  Trichinella spi...
EDV25935      44 -------CLrpfL---KDD--AKLSLQIYTSvkStKQS--------IRKL------------------SSIYTEEDF-HY 84  Trichoplax adha...
XP_015212343  51 ----NENCItsyL---AEK--PRLQLSIYTS--L-KPTg-------DGNQ------------------NLIFSMEDFeVF 93  spotted gar
XP_023186791  55 -------CIssyL---AAK--PRLQMSVFTC--L-VPD--------NSQL------------------TLALRVDLFdPH 93  southern platyfish
CBN75944     188 AgEAGDmtrstTLKLDLP-PMlLNNGSAWAH-VFLTKKGHSPnpnDPDYKDSGVSHQTAQLNRYLPKpkNKDGHYLVDSK 265 Ectocarpus sili...
Q96KA5        84 S-KFER-----TVNVSVPkKT-RNNGTLYAY-IFLHHAGVLP------WHDGKQVHLVSPLTTYMVP--KPEEINLLTGE 147 human
3_pfamImport  75 S-AFER-----QVNVSVPePT-RANGTLFAV-VYVHRAGVSP------LEDSREVHYAAQLTTYITP-------AYRDGQ 133
XP_013126123  83 S-KFER-----TINVSLPkKT-RNNGTLYAL-IFVHQAAHDP------WHDPRQVHSVAQLTTYMVP--KPPEISLISGE 146 Nile tilapia
Q6DHU1        83 T-KFEK-----LVNVSLPkKT-RKNGTLYAM-VFLHQAGVSP------WQDPHQVHLVTQLTTYMLP--KPPEISLITGQ 146 zebrafish
CAP25397      86 D-AFQK-----ELKVKIPsSV-AKDGYLYAH-TILLPHGFED---RNPMSAPWKVHVAAPMIVFQEP--VAKTFQLLGED 152 Caenorhabditis ...
KRY29656      89 T-YYNE-----LVEIPVPiKT-RKNGSLWLHsFLMPPSNVTI-----PFSGEWHLVQTAKMTTYAPR---KQEKYLLETT 153 Trichinella spi...
EDV25935      85 HkAFTK-----SVNVTLPsAV-VKNGTLFAH-IVIYPY-------LQMIDGHSLAYTIAPLTRYAIP--KADTQHLLSSS 148 Trichoplax adha...
XP_015212343  94 S-KFER-----KINVSIPkKT-RNNGTLYAF-VFVHKAGVSP------WHDSKQVHHIAQLTTYMVP--KPQEINLIIGE 157 spotted gar
XP_023186791  94 S-TFER-----QVSVSLPeET-QNNGSLYAV-VYVHKAGVSP------LEDRREVHYAAQLTTYITP---------PSTK 150 southern platyfish
CBN75944     266 KSAADAAVekerkel-----dekeaavALAGADRE--MINYWKPTLTLGQLDFTAIFQRNHIPSSFAGHITFQSST--GN 336 Ectocarpus sili...
Q96KA5       148 SDTQQIEA-------------------EKKPTSALdePVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGktVH 208 human
3_pfamImport 134 RDTQKVKRystssp--------rsentV-----------SHWRPHLAITLMSEDFTFNRAGLPSDVRRYMRVSQEGrqMI 194
XP_013126123 147 DKTQGQKEgqqkkphdavpgggaragaTSVSDHPV----SHWRSRLTVNIVGDHFLFDREYLPNDVHRYLRVFQNGkkVV 222 Nile tilapia
Q6DHU1       147 DEPEKPDQqkq--------------ssDSELDRPV----SHWRSRLTLNVVSENFLFDREALPGDVHRYMRVYQSGkkMI 208 zebrafish
CAP25397     153 EAVVEKP---------------------KKAKKVVe-LAAHFRTVLPVRIVSESSRFVKTKVSGELADFLTVQRQD---Q 207 Caenorhabditis ...
KRY29656     154 VNNSSEEyk---------------------------eIVTHFRTKLVLRGVGEPFSFVMRKLPNEFNSIFKITDRN---R 203 Trichinella spi...
EDV25935     149 IQNRCSSPli----------------iLQTLNRPK----SHWKKTVSVRLMTEKFLFDMKQFPAEIFSLLRLTNGD---Q 205 Trichoplax adha...
XP_015212343 158 DTSQQSEPqk---------------ktNGLQDRPV----SHWRSRLTLNVLSEDFAFDREALPSDVHRYMRVIQYGkrML 218 spotted gar
XP_023186791 151 GQKASRKk--------------------RESQRPV----SHWRPHLSITVMSEEFIFSKAGLPSDVRRYMRLSQEGrrMT 206 southern platyfish
CBN75944     337 YHPVLYVNEFWLQQKHLLALNSTVESVDLELSISPISLWKFQTMSQLESQWAAQAkIGMAGdGEQDTFRELLAETNPIVL 416 Ectocarpus sili...
Q96KA5       209 YLPILFIDQLSNRVKDLMVINRSTTELPLTVSYDKVSLGRLRFWIHMQDAVYSLQqFGFSE-KDADEVKGIFVDTNLYFL 287 human
3_pfamImport 195 YLPLLLVNELSFRVRDLLEISSSTVQLPLTVSYEGISLRGFRFWVHLQDVVYSLRqFGFTE-ENIDEIKETLLGSNLYLL 273
XP_013126123 223 YLPLLFVDELSNRVKDLVEINSTTTELPLTISYDSISLGRLRFWIHMQDAVYSLQqFGFTE-KDADEIKGIFVDTNLYFL 301 Nile tilapia
Q6DHU1       209 YLPLLFVDELSNRVKDLMEINSSSTELPLTITYDSIALGKLRFWIHMQDAVYSLQqFGFTE-KDADEIKGIFVDTNLYFL 287 zebrafish
CAP25397     208 YLPIMFVDEMSMRSKHLFELADFQKSVNLTINYEPTSVAKLLLLTSTARSTQQLMrHGFKD-KDIDELRGLFTETSIVLL 286 Caenorhabditis ...
KRY29656     204 YYPLFYVDYLAFTEDNLQEISVNTSRINITVVYYPTSVGHLRMLISVRDALRQMKeMGLGR-VDIDMIVGILQEDHLGLL 282 Trichinella spi...
EDV25935     206 YLPFLHVTEMSQTLRQAEVIDVNTTVKVLHIDYQPISVGALRFWVSMEESMKLIRkLGFSD-NDIDKVKGIFSSGNLKLL 284 Trichoplax adha...
XP_015212343 219 YLPILFIDELSNRVKDLMVINSSTTELPLTISYDTISLGKLRFWIHMQDAVYSLQqFGFTE-KDADEIKGIFVDTNLYFL 297 spotted gar
XP_023186791 207 YLPLLLVNELSCRVKDLMEINGSSMQLPLTVSYEGISLRTFRFWIHLHDIvyslrqfgfteenideiket-ligsnvyll 285 southern platyfish
CBN75944     417 VITMIVSLLHS-VFNFLAFKNDISFWKDKkRSLEGISVRGMLVNLFFQAVIFLSLADNDTTYMILVTNAIGLAIEVWKVG 495 Ectocarpus sili...
Q96KA5       288 ALTFFVAAFHL-LFDFLAFKNDISFWKKK-KSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLVPAGVGAAIELWKVK 365 human
3_pfamImport 274 VLTALITALQL-ICEFLALKNDFSSWRKK-KSMVGMSRKSVQWRSLSTLLIFLHLLQE-TSLLVLLPVGLGACVEVWKVF 350
XP_013126123 302 ALTFFVAAFHL-LFDFLAFKNDISFWKQK-KSMVGMSSKAVLWRCFSTIVIFLYLLDEQTSLLVLIPAGIGSMIEVWKVK 379 Nile tilapia
Q6DHU1       288 ALTFFVAAFHL-LFDFLAFKNDISFWKHK-KSMVGMSSKAVLWRCFSTIVIFLYLLDEQTSLLVLVPAGIGSLIEVWKVK 365 zebrafish
CAP25397     287 MITFFVSTLHL-LFDALAFKNDISFWKGR-KSMVGLSTKTLLWRCFSQTIIFFYLFDQETSLLVLIPSGIATVIEYWKVT 364 Caenorhabditis ...
KRY29656     283 FFGFAVAILHS-VLDFLALKSDVSFWRGQ-KSMVGVSRRTQALRMFSEVVIFFYLINNKAGFLVWLPVFVGMLIDVWKLA 360 Trichinella spi...
EDV25935     285 LLTFVISLVHV-LLDFLAFKNDVNFWKGR-KTTAGLSPTTVIWHSFSYSVIFLYLLDEDASYLVIVPLGISTIIEIWKLA 362 Trichoplax adha...
XP_015212343 298 ALTFFVAAFHMqMFTW-CSCSHFFCFLCQ-----------VLWRCFSTIVIFLYLLDEQTSLLVLIPAGIGSIIEIWKVK 365 spotted gar
XP_023186791 286 vltalitslqL-ICEFLALKNDICSWAKK-KSMVGMSRKSVLWRCLGTLLIFLHLLEE-TSLLVLLPVGLGACVEVWKVF 362 southern platyfish
CBN75944     496 RFMVGRLDWggeDGQprrwVP---RMMFQAKESYRKS--KTKEFDDVATAHLLYLVGPLMVGYAAYSLLN 560 Ectocarpus siliculosus
Q96KA5       366 KALKMTIFW---RGL----MP---EFQF---GTYSESerKTEEYDTQAMKYLSYLLYPLCVGGAVYSLLN 422 human
3_pfamImport 351 TVFKIQFQW---KSS---------KLHV---NKLDEEerKTVEYDTQASRYLSYLVYPLCISGAIFSLAY 405
XP_013126123 380 KAFKIQVFW---KGG----KP---TFLF---GKLDESerRTEEYDTLAMKYLSYLLYPLCIGGAVYALIF 436 Nile tilapia
Q6DHU1       366 KAFKIHVIW---RGL----TP---TFLF---GKLDESekRTEEYDTLAMKYLSYLLYPLCVGGAVYALVF 422 zebrafish
CAP25397     365 IAYKVSISW---RGI-----------KF---GKHSAEedETDSIDAQAMKYLSILLVPLVIGGAVYSLLY 417 Caenorhabditis briggsae
KRY29656     361 KCFKFQIRR----------VGwrfECSF---AEISSEesETDEIDKLGMKYLMYVMAPFSVVGAGYSLIY 417 Trichinella spiralis
EDV25935     363 KVFKVTLERk-pEHW----LP---SIQF---GQRSKAeqESESYDLEAIRYLSYFLYPLVLIGAIYCLIY 421 Trichoplax adhaerens
XP_015212343 366 KAFKIHVLW---KGL----KP---TFQF---GKSDESerKTEEYDTQAMKYLSYLLYPLCIGGAVYSLIY 422 spotted gar
XP_023186791 363 KVFKIQISR---R---------------CHTNKLDEEerKTVEYDTQASRYLSYLVYPLCISGAVFSLGY 414 southern platyfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap