Conserved Protein Domain Family
DUF773

?
pfam05600: DUF773 
Protein of unknown function (DUF773)
This family contains several eukaryotic sequences which are thought to be CDK5 activator-binding proteins, however, the function of this family is unknown.
Statistics
?
PSSM-Id: 398951
Aligned: 46 rows
Threshold Bit Score: 287.65
Threshold Setting Gi: 552818772
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_005845265  23 LPI-DVQYTKLSEWLVDRKQVPADWNRKLQAIQAKAAAAVRELPpG------------FLGQFE-GgedAPLDYFQAQRV 88  Chlorella varia...
EEY59584       7 LPI-DIQYKQLLEALVDRRIVPNKWLEQHKQIRDAIAALYLELPlAse---------aLSKFRSkKpshEDLNYFDCKFI 76  Phytophthora in...
XP_004234786  10 LPI-DIAFTRLGEWLVDRKRIPADWRKRLAAVRAKITTSFASLPrDid---------pYFHTLD-I---EGIGYLEAKKI 75  tomato
XP_010653907  10 LPI-DITFSRLGEWLVDRKRVPADWRKRLTSIRARISTAFASLPkEid---------pYFQTLD-P---EGIGYIEAKQI 75  wine grape
XP_003535845  10 LPI-DITFSRLGEWLVDRKRVPADWRKRVAAIRARISKEFPSLPkDsd---------pFFQTLD-P---EGINYLEAKQI 75  soybean
XP_009122300  10 LPI-DITFSRLGEWLVDRKRIPADWRKKVAAIRVRISKEFSSLPkEid---------pYFQTID-P---DVIGYLEAKRI 75  field mustard
EEF30042      10 LPI-DITSSRLGEWLVDRKRIPSDWRKRIAAIRARISKELSSLPkDid---------pYIQTLE-P---EGIGYLEAKKI 75  castor bean
XP_006656040  10 LPI-DIAFGRLQEWLVDRKRVPQDWRKRLAGVRARVAAAFASVPrEld---------pSLLALE-P---DEIGYLEAKKI 75  malo sina
EGG18868     239 IPIvDIPGAKILDWLVERKKVPMHWKRNNGNLIKLIEDTMTSNP---------------SQLLK-DlkiENIDYFKCLEV 302 Cavenderia fasc...
EFA79352      70 LII-DLQGSKIMEWLLDRKKLPQHWKRNAVHLKKLIDEAIRTSPpTnvklpeshrlddDDETVGh---sDRLNYFKCQTV 145 Heterostelium a...
XP_005845265  89 LAKL-SETAE--KSLLGSL-KGAAGEWDKVVRAYEYNLIYLAEAAQTLCRNADFEIPFLKKQAAKCQQQLADLEKRKAEA 164 Chlorella varia...
EEY59584      77 FQCLeQSDEGasKNFFGQYtSPVLKRWSALIRQYQKNNVFAAETARIIAQNTAFEIPFLKKSIQQNEKQVADNNRKMADL 156 Phytophthora in...
XP_004234786  76 YEIL-LKSTQesRNIFGRL-SGDAGVWEAVVRAYEKEYIFLGESAQIMVQNVNYEIPYQKKQIQKTQQQLAELERKEADI 153 tomato
XP_010653907  76 YDIL-LRSTPesRNIFGRL-SGAAGVWEAIVRAFEKDHIFLGEAAQIMVQNVNYEIPYQKKQVQKIQQQLAELERKEADI 153 wine grape
XP_003535845  76 YGNL-LKSTSesRNIFGRL-SGAAGVWEAIARSFEKDHVFLGEAAQILIQNVSYEIPYQRKQVQKIQQQLSELDRKEADI 153 soybean
XP_009122300  76 YEIL-LKTTPesRNIFGRL-SGASGVWEAIVRAFEKDHVYLGEAAQIIIQNVNYEIPYLKKQVQKVQQQMSELDRKEADI 153 field mustard
EEF30042      76 YDTL-VKTTPesRNIFGRL-SGAAGAWEAIVRSFEKDHIYLGEAAQIIIQNVTYEIPYQKKQVQKIQQQLAELERKETDI 153 castor bean
XP_006656040  76 YGIL-LESNTesRNIFGRL-TGSAGEWEAIVKAYEKDHLFLGEAAQIMVQNVNYDIPYQRKQMQKTQQQLAELDRREADI 153 malo sina
EGG18868     303 FKYFeSQPSGnsKTLLGYYsNINTQKWNDVIKAYHKDQLYIGENCQRLTQSLNYDIPNMKKTIEKTMKSLEESNKKEIEL 382 Cavenderia fasc...
EFA79352     146 LQDClDAPNGsaKTLFGGYsNNATQKWNDVIKAYQKDYLYIGESCQTFTQSINYDIPNLKKIVEKSTRSLEDYTRKDQEY 225 Heterostelium a...
XP_005845265 165 GRSAAAAAAEFQQAreCSALGIDCSNIRGGLLGLT-AELPALAAAAVEALQAegVSQGMQYYASVAGSQQQE-------- 235 Chlorella varia...
EEY59584     157 TRSIAEYKRKLETS--CADMGIAGENFREELRRLP-MELPSLFDGVAKAICSdeIATAIEYHQALQAYLHDCeipvvvte 233 Phytophthora in...
XP_004234786 154 KRNAALSASKYVEA--CQELGLQGVNVRSELLETStISLPSTFSRILEVLTGdsVSRAIEFYSEFVKDVHTEk------- 224 tomato
XP_010653907 154 KRNAALSAAKYAEA--CQELGLQGNNVRLELLETT-KTLPSIFSKFLEVISSdcVLRAMEYYSNFVRDAHTEk------- 223 wine grape
XP_003535845 154 KRSAALSATKYAEA--CQELGLQGKNVRVELLETA-QLLPSTFSKILDVVNSgnMSRAIEYYSNFVRDAHTEk------- 223 soybean
XP_009122300 154 KRSVALSATKYEEA--CRELGLQGNNVRRELLETA-NSLPTTFAKILEVINSesVSAAMEYYSAYVKDVHTEk------- 223 field mustard
EEF30042     154 KRSASLSAAKYMEA--CQELGLQGNNVRSELLETA-KSLPSTFNQILEVINSdsMLKAIEFYSTFVRDVHTEk------- 223 castor bean
XP_006656040 154 KRLAALSASRYAEA--CQELGLQGINVRQELIESA-KTLPSTFTKILEVLNSdpVSKATEYYTTFVRDCHAEd------- 223 malo sina
EGG18868     383 TKSRETAINTFKKA--CSDIGIKGDKIRDEILELP-NGLDKLFEKAIQLLQDgrILGMIRFYKQFAQTNTCE-------- 451 Cavenderia fasc...
EFA79352     226 TKSRSSAQSALKKA--CQDLGIKGEKIREEIEELP-KNLESIFDSVINLVNNgtLLKSINFYREVINATNCE-------- 294 Heterostelium a...
XP_005845265 236 -------QGEAALLPVLAEVREG---------RTEAPAAaaaaeaparsasgdgg-----daaaadsggsaatglQLDWd 294 Chlorella varia...
EEY59584     234 sisssssKKKKKSKKQVEAAEEPevttdepfeLVLAPHKffaaieelrnasnel-------vettatldfeaeaaEISWd 306 Phytophthora in...
XP_004234786 225 ------dKTVAVVLSNLRSARER------------PPAIdvsvstevlevmnaqag---yhglsqitvetdtvadGVDW- 282 tomato
XP_010653907 224 ------dKMSRTVLINLGDVREN------------PPCLnvsagsdvldsmnvqps---shetnnmtevmdvpadYIDW- 281 wine grape
XP_003535845 224 ------dRSLGDVLQNLKSMCEN------------PPSLnvavdseiindvnvhss---knefdpainnaeiavpDIDW- 281 soybean
XP_009122300 224 ------dKPARVVLENLKDIREN------------PPSLsvlgafealdgdnv--------qssenangtdvaadSIDW- 276 field mustard
EEF30042     224 ------dKSSWIVLWNLREIREN------------PPTLnvsagpeildimnlqls---hnetshvrgdmdvtadNIDW- 281 castor bean
XP_006656040 224 ------kENCKSVLQNLKQLQAN------------PPSLhisvcnevetslgetskahgsnvtgeeniasnmsadDIDW- 284 malo sina
EGG18868     452 --------LKEEIFSYLLLVNKHgnisigereMILNPSIivkskkdqnvdsn----------nsgsdlvaltapaTIDWd 513 Cavenderia fasc...
EFA79352     295 --------LNGELLALTNFLIQHgnitlgereAILDPTykvpkrvntte---------------saqqqqqqqqpQLNFd 351 Heterostelium a...
XP_005845265 295 lgaalgaaggeeagggGAAVPAAGISWDldasdlaaaaedggddaagagggaaggiswevevdpadvaaaadvaadvaae 374 Chlorella varia...
EEY59584     307 isl----------dgsGTAE-VGEIDWGietvaste-------------------------------------paeitvd 338 Phytophthora in...
XP_004234786 283 ----------------DITLDSSQIDWDigtveeteengnglgpyeivnasdi---mssprkddvkshqtsmeegflape 343 tomato
XP_010653907 282 ----------------DISVDSSQIDWDigtveetddtgnglgpyeivnaseilqnisptaavesdqtllkkeedglvpg 345 wine grape
XP_003535845 282 ----------------DISVESSQIDWDigtveetedngnglgpyei----------------inasdigsdptisnqei 329 soybean
XP_009122300 277 ----------------DITLDTAEIDWDvsmveevdggndlgsye------------------ivdasdipenkveggpe 322 field mustard
EEF30042     282 ----------------DISVDSTQIDWDigateeiddgsnglgpyeivnasdilqsssqneavesdlnssskgednlhpe 345 castor bean
XP_006656040 285 ----------------DISLDDNGIDWDigaveqpveesgngfgsyeiidan-----velagsenynfgisddpsvnkss 343 malo sina
EGG18868     514 fsve-------esgsqLDEKAAASINWD---------------------------------------------------- 534 Cavenderia fasc...
EFA79352     352 id------------tnVGGAAAGGINWEiddq--------------------------------------------ltai 375 Heterostelium a...
XP_005845265 375 VAPAEIAW-------------------------DIDISGVGEESEQQeqqlagarqqgagageadgpsaAAAAAAAADEP 429 Chlorella varia...
EEY59584     339 DAPVEIDW-------------------------DITTSDAVEP-VNEvsapeaa-----------dvvepvpIT-TGQAT 380 Phytophthora in...
XP_004234786 344 VSASEISW-------------------------NVSVDNPQVDVIDKsqnnave------------lhslqnNLTANPVA 386 tomato
XP_010653907 346 MSASDISW-------------------------DICVENPQVDEVEDvifpned---------mktqasVLDTKTRTPEI 391 wine grape
XP_003535845 330 gSHADISW-------------------------DISVDTPQVDVIDDdnaptvv---------lenqtsLPDSLSQLTGN 375 soybean
XP_009122300 323 VDVSEISW-------------------------DVSVETPQVEEIADssslesg------------qekqiqSIDQVLGS 365 field mustard
EEF30042     346 ISVSEISW-------------------------DISVEPPQIDVVDDvdspntg---------lenqkyVPDSLTHNSGV 391 castor bean
XP_006656040 344 sSEPGICW-------------------------DITDDNPE----ENatmqnap------------------esgqpqSS 376 malo sina
EGG18868     535 ------EFtvvleedgttnsssvaddfsmmdtiEIVEEANTISSPILest-----------------ttITDNIKFMDNA 591 Cavenderia fasc...
EFA79352     376 QEPAEIKWdedfsvidsstsqdivddfsmmdaiEIIDESNSPVLLSAsdasqqqi------tldggdnsGSGNTKVIDNP 449 Heterostelium a...
XP_005845265 430 AtirRLIEDAAYRARLLDDLYELRAFLMQRCRELSGRSsELL----LAAAAEGGLHVSADQATDMVGAVDEALARFGGDK 505 Chlorella varia...
EEY59584     381 Rv--GLLDDNEFRTRVLNDLLELRAFLRQRLVELSGSD-SVAfanqFQGSSSLLEQQSTAKIEELQAAVDGAVSLLTSKR 457 Phytophthora in...
XP_004234786 387 IhdrSPLLETEYRNKILDDLFEVKAFLNQRFIELRNEDtTSLqhqvQAVAPLVLQQYSSDIIQTMLSDVSSAISLLTNRK 466 tomato
XP_010653907 392 KedrSQLLETEYRNKILDDLFEMKAFLNQRLVELRNEEtLSLqhqvQAVAPFVLQQYTPDAIQAMLSDVSSAISLLTNRK 471 wine grape
XP_003535845 376 KeerSQLLDTEYRNKILDDLYEMKSFLNQRLAELRNEEtLSLqhqvQAVAPFVLQQYAADAIETMQNDISLAISLLTNRK 455 soybean
XP_009122300 366 GeerSQLLETEYRNKILDDLYEVKAFLNQRLVELRNEDtLSLqhhvQAVAPMVLQQYSPEIIEPMVVDISMAISLLTNKK 445 field mustard
EEF30042     392 KeerSQLLGTEYRNKLLDDLHEMKAFLNQRLAELRNEEtLSLqhqvQSVSPLVLQQYAPDAIETMLSDVFLVISLLTNRK 471 castor bean
XP_006656040 377 AeerSQLLEKEYRNNILDDLLEVKAFLTQRLGEMRNADtSSLqhqvQAVSPFVLQQYAPENLENMLAEVSSAISLLTNQK 456 malo sina
EGG18868     592 Ne--SIMSDKIFRNRLLDDIYEMDIFLKQRAVEMNQPes------eFSAIHMMQESITLDQCEQYSKLIGDIISQLSSSK 663 Cavenderia fasc...
EFA79352     450 Fe--SILGDRTLRNQFLDELYELEIFLKHRSVEMAAPeh------vFGIDQINVESTNLDQCKQYLKQVTEIITLMTNHK 521 Heterostelium a...
XP_005845265 506 LKQLIALRTSSHYLDRLAAGLQQKAAQEAK---AAAEAEARRGGIQSQLMADSAKLAVLVKHTRQAKEEVERALSAKLG- 581 Chlorella varia...
EEY59584     458 LQQLVLIKTSERYLDRHVASLEMLTKHMDKcgrEIHALEDKNVDLIDATKNVQPQINALVATTKKLKKELEAALPPLFKg 537 Phytophthora in...
XP_004234786 467 TRDMIMILNSVRFLDRLVNTLEEKKRQEAKlkdGLKDLSSKRMELQNSMSSSWPKQEAALAQTRELKKLCESTLSSMFEg 546 tomato
XP_010653907 472 MQDLIMILNSKRFLDRLVSTLEEKKHHEAKlkeGLKDLTIRRMELQNSLSSSWPKQEAALAKTRELKKLCESSLSSMFDg 551 wine grape
XP_003535845 456 TRDLIMILNSKRFLDRLVNSLEEKKQHEVKlkeGLKDLAAKRMELQNSLSSSWSKQDVAVAKTKELKKLCESTLSSMFDg 535 soybean
XP_009122300 446 TRDLVMILNSKRFLDRLVSELEEKKHREVKlkeSLKDVGRRRMELQNSLSSIWPKQEAALVKTRALKELCETSLSSIFEg 525 field mustard
EEF30042     472 TRDLIMILNSKRFLDRLVNTLEEKKHHELKlkeGLKDLAAKRMELHNSLSSSWPKQEAALAKTRELKKLCEGTLSSMFDg 551 castor bean
XP_006656040 457 TLDLIMILNSKRFLDRLVSTLEDKKHHEVKlreGLGDLSVKRMELQNALSSSWPKQEAAITKTRELKKLCEATLSSVFDg 536 malo sina
EGG18868     664 VNNILELKSSSKLVDRMALQFTQKIGTITKyqqLIKDLLQKREDLNTTLTETKTKLESQTKETKQLRLQLQELLVDIMDg 743 Cavenderia fasc...
EFA79352     522 IKHILEIKSSKKYIDRLVLQFNQKQGNIAKytqMIADLDLKRKEVNQTLTESRKKLDQLIKDTRVLKTKLEGILVDVLDg 601 Heterostelium a...
XP_005845265 582 RRINVMG 588 Chlorella variabilis
EEY59584     538 YKVNIVG 544 Phytophthora infestans T30-4
XP_004234786 547 RPVNIIG 553 tomato
XP_010653907 552 RPVNIIG 558 wine grape
XP_003535845 536 RPVNIIG 542 soybean
XP_009122300 526 RPVNIRG 532 field mustard
EEF30042     552 RPVNIIG 558 castor bean
XP_006656040 537 RPVHIIG 543 malo sina
EGG18868     744 KHINIMm 750 Cavenderia fasciculata
EFA79352     602 KKANLMi 608 Heterostelium album PN500
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap