Conserved Protein Domain Family
Taeniidae_ag

?
pfam05596: Taeniidae_ag 
Taeniidae antigen
This family consists of several antigen proteins from Taenia and Echinococcus (tapeworm) species.
Statistics
?
PSSM-Id: 398948
Aligned: 6 rows
Threshold Bit Score: 85.8983
Threshold Setting Gi: 74841733
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CDS37956 22 DEKTSDdPKKEIMMLMGETRRFFREDPLGQKIVDHFQELVSICKALRERVRKRLGEYLKGLENE 85  Echinococcus multilocularis
Q867W3   21 DDGLTS-TSRSMMKMLGEMKYFFERDPLGQKLVDLLKELEEVFQMLRKKLRTALKSHLRELVAE 83  Echinococcus multilocularis
Q5FAR6   22 AE--PErCKCLIMRKLSEIRDFFRSDPLGQKLVALGRDLTAICQKLHLKVHEVLKKYVKDLLEE 83  Echinococcus multilocularis
Q5FAR7   21 KDEPKAhLGQGIKKRWGELRDFFKNDPLGQRLVALGNDLTAICQKLQLKIREVLKKYVKNLVEE 84  Echinococcus multilocularis
Q5FAR4   21 EDDIDSkSKKGVMKSVAELKEFFASDPMGQKLAAICKELKDFFLLARTKARSALRDYVKRLMDE 84  Echinococcus multilocularis
CDS36679 21 DDDEVTqTKKGVMKAISEIKHFFQSDPLGKKLVEVMKEVGSVCQMVRKKARMALKEYVRKLIKE 84  Echinococcus multilocularis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap