Conserved Protein Domain Family
Anth_Ig

?
pfam05587: Anth_Ig 
Anthrax receptor extracellular domain
This region is found in the putatively extracellular N-terminal half of the anthrax receptor. It is probably part of the Ig superfamily and most closely related to pfam01833 (personal obs: C Yeats).
Statistics
?
PSSM-Id: 398942
Aligned: 41 rows
Threshold Bit Score: 94.5957
Threshold Setting Gi: 859853225
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011537744 249 KVCLDVTSVEPSSECVGEPYHVVIHGNGFQ----NLKKRDEVICRFIFNESTIIDEKPTSIDNNSMNCPGPKLEKPGEEY 324 human
Q8BVM2       250 KSCTEILSVQPTYVCAKDFYQVNISGHGLN----NTSNMKQVICRFKFSDSKVVDESPSDMNEHSITCPGPKIKHTGEDV 325 house mouse
XP_008268121 250 QSCIEVTSMEPSTVCVGESSQVVINGKGFH----NAKDQDQVICRFTVEESMVVDEKPSSMDENVITCPVPVIDEANKLI 325 rabbit
XP_025138338 234 NSCMEAMAGDTHFVCLGVAYEVTFFASGL-----DEKRKDEIVCRYQLGSSKVFDKKPISMNQGKLICPGHIFDKAGQEV 308 water buffalo
XP_004765880 256 nTCKKMKSAGVYFVCLFETYDV-----GFEtpvpDPSNIENFVCEYTLDGDPLPNRRANIVTSHSIICPGHIFETEDREL 330 domestic ferret
XP_008517479 260 KCCMEITAVEPSSFCTGETYEVKISGKGFN----NAKNKDEVICRFKFSNTELFDKKATSVEDTTIICPEVKIEKPGQEI 335 Przewalski's horse
XP_017897645 219 KSCIEITSVEPSDICVGDEYELTISGKGFN----NAKNEDEVICRFKFKDKL-IDEKASSVKDTSVICPGIKIESPDEAF 293 goat
XP_008694550 554 KSCIDVTKVEPSSFCAGENYELMVTGTGFN----NAKHKDEVICRFIFSENKFFDKKATSVEETTMMCPGVTIDSPDQVV 629 polar bear
XP_025290218 265 KSCIEITNLEPSTFCAGQNYELMVSGRGFN----NARNPEEVICRFIFTDKkFYDKKATTMDDTTVMCPGVTIDNPDEVV 340 dingo
XP_024842658 254 NSCKQVMGKDTFYACVGESYQLGFFAHGL-----NPDKIKEYTCRYKLDEIQVYNKEPASVSNEKITCQGHIFAKTGQVI 328 cattle
XP_011537744 325 SIEVSLNKGKTFFKSNVSITSTTC 348 human
Q8BVM2       326 SLQVSLNNGISFIGNKLIITSTNC 349 house mouse
XP_008268121 326 FLEVSLTNGKSFIGNKLNMTSTHC 349 rabbit
XP_025138338 309 FIDYSLNNGVSFVGEDLKIVSKDC 332 water buffalo
XP_004765880 331 VVRYSMDAGVTFQDS-MVFSGTNC 353 domestic ferret
XP_008517479 336 TTEVSLNNAISFINNDVRISSKDC 359 Przewalski's horse
XP_017897645 294 SLEISLNNGISFINNDVSLTSKDC 317 goat
XP_008694550 630 FVEVSLNNGLSFISNGANITSKNC 653 polar bear
XP_025290218 341 FVEVSLNNGINFIKSNANITSKNC 364 dingo
XP_024842658 329 IVDYSLDLGKTYSKRFLKVTSKDC 352 cattle
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap