Conserved Protein Domain Family
Ant_C

?
pfam05586: Ant_C 
Anthrax receptor C-terminus region
This region is found in the putatively cytoplasmic C-terminus of the anthrax receptor.
Statistics
?
PSSM-Id: 398941
Aligned: 21 rows
Threshold Bit Score: 139.366
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001096038 391 VRWGEKGSTEEGTRLAKAKNAVVKMPEEEFEEPVitPPPRPPPTYQAPVPDKWYTPI-KGRFDAVAALLRRQYDRVAIMR 469 zebrafish
XP_027880885 415 VRWGDKGSTEEGAKLEKAKNARVVMPTPEYDPPP--PRLYYHT-RKTISSQKWYSPI-KGKLDALYVLLRRGYDRVSVMR 490 Monterrey platy...
CAF99285     437 VRWGDKGSTEEGAKLEKAKNARVVMPTEEESL----ARPYHAA-HKPVRSHKWYSPI-KGKLDALCVFLRKGYDRVSIMR 510 spotted green p...
2_pfamImport   1 VRWGDKGSTDEGARLEKAKNAVVTMPEEEEEQLPl-PAPKKPKPTSQVHQTKWYTPIkKGRLDALWALLRRQYDRVSLMR 79 
XP_005804020 387 VRWGQKGSTDEGSRLEKAKNATVTMPEEVEEPIIprPPPRPPPVHNSPTQTKWYTPI-KGRIDALMALLRRQYDRVAIMR 465 southern platyfish
XP_004075042 383 VNWGQRGSTKEGSRLEKAKNASITMPE-EPEISQ--LPPKETPAHAPPPQPKWYTPI-KGRVDALLALLRRQYNRVSIMR 458 Japanese medaka
XP_015221079 391 VRWGEKGSTEEGARLEKAKNAKIHVLEEVEEPMM--KKPSRPPPVYHPPESKWYTPI-KGRLDALWALLRQQYDRVSLMR 467 spotted gar
CAG09629     352 VRWGEKGSTEEGARLEKAKNAVVTVPEEEPELPQs-RRSAATAPRYHRNQNKWYTPI-KGRLDAVWALLRRQYDRVSLMR 429 spotted green p...
CAG04904     423 VRWGQKGCTEEGARLEKTKDAVVTMPEDVDEPIVrrPPPRPPPVYNPQAQDKWYTPI-KGRFDALMALLRRQYDRVAIMR 501 spotted green p...
XP_029299973 318 VRWGQMGSTEEGSRLEKTKNAVVTMPEGEEEPIMsrPPPRLPPIYNPPSQSKWYTPI-KGRFDALRALLRRQYDRVAIMR 396 Cottoperca gobio
NP_001096038 470 PTANDKGRCIKFTRVQ 485 zebrafish
XP_027880885 491 PYPGDKGRCINFTRSp 506 Monterrey platyfish
CAF99285     511 PLPGDKGKCINFTRSR 526 spotted green pufferfish
2_pfamImport  80 PQQGDEVTLRNLQRT- 94 
XP_005804020 466 PTPQDKGRCINFTRVR 481 southern platyfish
XP_004075042 459 PSPREKGRCVNFTRVR 474 Japanese medaka
XP_015221079 468 PQPEDEGRCINFSRVQ 483 spotted gar
CAG09629     430 PTSEDKNplrlvaaat 445 spotted green pufferfish
CAG04904     502 PTSQDKGRCINFTRVQ 517 spotted green pufferfish
XP_029299973 397 PTTQDKGRCINFTRVQ 412 Cottoperca gobio
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap