Conserved Protein Domain Family
DUF1758

?
pfam05585: DUF1758 
Putative peptidase (DUF1758)
This is a family of nematode proteins of unknown function. However, it seems likely that these proteins act as aspartic peptidases.
Statistics
?
PSSM-Id: 147642
View PSSM: pfam05585
Aligned: 3 rows
Threshold Bit Score: 244.068
Threshold Setting Gi: 74834807
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4EAY5  503 VYVQNANGI--YTSCRLLFDSGSELSYISERCINALGLARSSSRILVSGISAIKAEATRGVTQLHLKSRVSDNT-LKITA 579  Wolbachia endosymbi...
Q4E9M7    2 VNVRNAKGD--LVACRLLLDTGSELSYISERCIQTLGLARTPSRILVTGISSTKADTTRGCSTISIQSRISQDQ-LVVQA 78   Wolbachia endosymbi...
Q17051  458 VVVSNPQKAncRTKALMFFDSGSQKSYITTRLANRLRLNTTPQK-LSISTFGDCAPQIIQSNRTVISVQLQNGTrKAVRV 536  common roundworm
Q4EAY5  580 HVLSKITSSLQRHNVDPSSLNVFNGFLMADTNFASVAPIDILLGSDYIWATLTGQKMHDNMGNLIAISSIFGWVITSVGV 659  Wolbachia endosymbi...
Q4E9M7   79 HVLGKITSSLERQTIDASVLRVFNDLQLADSQFSTNAPIDILLGSEHVWSVITGRKIYDDKGKLIAISSIFGWVITSLLS 158  Wolbachia endosymbi...
Q17051  537 STIKRITSNLE--VIGDNIEAHFGDLKPSEl-pRKIRSPDILIGHDYFSDFIPLTGIKRLGNGYELIPTKVGYILSSKQA 613  common roundworm
Q4EAY5  660 NQSPTTT 666  Wolbachia endosymbiont of Drosophila ananassae
Q4E9M7  159 SRACSAT 165  Wolbachia endosymbiont of Drosophila ananassae
Q17051  614 EKKEAAP 620  common roundworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap