Conserved Protein Domain Family
Peptidase_U57

?
pfam05582: Peptidase_U57 
YabG peptidase U57
YabG is a protease involved in the proteolysis and maturation of SpoIVA and YrbA proteins, conserved with the cortex and/or coat assembly by Bacillus subtilis.
Statistics
?
PSSM-Id: 398940
Aligned: 69 rows
Threshold Bit Score: 358.716
Threshold Setting Gi: 524608602
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Desru_0149   5 QEGDIVARKSYENDLFFKVTDIYrGDDGRDYAVIKGLDIRLFASSPVDDLQKIDAKDVATYWTQTLRKNAEIMDRV---- 80  Desulfotomacu...
CDC07032         5 KKGDIVVRKSYGKDIIFRVINIL-NKPEEKIAVLNGVIERIEADSKIADLELVDKQKVKDILRKMDSKIENRIEKSkqqw 83  Clostridium s...
CDE14619         5 KKGDIVARKSYGKDIIFYIKKII-KNSNSEVAILCGLFERIEADSSVDDLELLDHNFVKKMFSNEEKRLSSRIDTKnndy 83  Clostridium s...
CDE24751         5 KKGDIVGRKSYGKDIIFIVERII-QNKNDKIAILKGLVERIEADSDVDDLEIIEKRKINRSLENLNEKVELRLDRYskaq 83  Clostridium s...
CDA16956         5 KKGDIVGRISYGKDILFVVDRIIkTNSRNEIAILKGLTIRIKADSNIEDLEVIEKRIVKEKIQLFENRIEDELKKCl--- 81  Clostridium s...
CDD15977         5 KRGDIVGRISYGKDIIFVVEDIM-KVNNKEVAILKGVTIRIKADSPLDDLEILSKELVEENERKLEKRFQERIKRCsql- 82  Clostridium s...
CDD26896         4 KKGDIVGRKSYGKDIYFIVNQILtTTRNHKFAILKGLNIRIEADSPIEDLEIIGKDEIISSIKKYDSFLEERIKKNri-- 81  Clostridium s...
CDA59481         4 RKGDIVGRLSYNKDIVFTVSNII-KCRNQDIAILKGLVTRIEADSPLDDLELIDNNRVINLLDSFEKELEKSKKNLv--- 79  Clostridium s...
jgi:Ccel_0237    5 HIGDVVTRRSYGGDILFKVVNIKtNFNGSESYVLRGLSYRIEADSQADDLVKQDARTAYTRAINELDRVKKSIDCSvpvf 84  Ruminiclostri...
WP_003513147     5 KIGDIVTRKSHGQDIYFIVTDIQnKDSSKPVYILRGLFYRIIVDAFEDDLVKKDSRSTRINLRRDLTMARSNAYRQifts 84  Hungateiclost...
jgi:Desru_0149  81 --MKRRVEERGhrikrctdghcflsrtgrvegQQETDEIEGFDVPGSVLHLDGDKDYLDLCMTTYRNLSIPAYGYAVKEE 158 Desulfotomacu...
CDC07032        84 edr-----------------------nyrigvVTNQTRAKEKIITGEILHLDGDRKYSEKSYRYYRKLGLNAIVKYIPEY 140 Clostridium s...
CDE14619        84 ----------------------------rfnsFEDSLNLRKKIITGKILHLDGDKRYSQKSYNYYKKMGLNAIVKNIPEY 135 Clostridium s...
CDE24751        84 nkn-----------------------diknslFGNNRKNQERTITGKILHLDGDRKYSQKSYMYYRKFGLNAIVKNIPEH 140 Clostridium s...
CDA16956        82 -------------------------------kYIELDKRGKDVLAGKILHLDGDKKYSEKSLRCYRSLGLEAIVKNIKEN 130 Clostridium s...
CDD15977        83 ------------------------------ysNSKNNREREIIYTGKILHLDGDKKYSVKANNYYKKIGLNAIVKNIAES 132 Clostridium s...
CDD26896        82 ------------------------------yeSNEKNFTRQKIYLGKILHLDGDRRYSDKSAKYYNKAGLNAIVKNVPEN 131 Clostridium s...
CDA59481        80 -------------------------------nVQNNMFKRYYQHYGRILHLDGDRKYSEKSQKVYKSMGLNVIVKNIPES 128 Clostridium s...
jgi:Ccel_0237   85 ktFLSRIKHK----------------------------------PGRILHIDSAEDFMNECLDFYKKSKINCYGKWVSEN 130 Ruminiclostri...
WP_003513147    85 rcFLFSKPRQR---------------------------------PGKVLHIDSSESFLKMCRNLYKEAGITSREYLAPES 131 Hungateiclost...
jgi:Desru_0149 159 EQPKRVKELLQKHYPDILVLTGHDGLKKGAKDLTDINNYHNTKYFIEAVKIARTFEKSKD-DLVIFAGACQSCYEAILSS 237 Desulfotomacu...
CDC07032       141 RQPRVVYQLLESYNPDILVITGHDGMIKRGMRYNDIYNYRNSRYFIETVKEARKYDKQKGkKLVIFAGACQSYFEAIISA 220 Clostridium s...
CDE14619       136 KQPHVVYKLLKIYQPDILIITGHDGMIKKGSNYNDIYNYRNSRHFINTVKEARRYDKENQtDTVIFAGACQSYFEAIMMA 215 Clostridium s...
CDE24751       141 RQPYEVYRLLKIYNPDILIITGHDGMIKRGKEFNNIYNYRNSKYFIQTVKEARRYDKEVNkNLVIFAGACQSYFEALISA 220 Clostridium s...
CDA16956       131 EQVRFVKSLLERYRPDILVITGHDGMLRGETKYNDIYNYRNSRYFINSVMEARRWDNKGR-DLVIFAGACQSYYEAIIGA 209 Clostridium s...
CDD15977       133 KQSSVVADLLIKYKPDILVITGHDGMIKKGTKYNDIHNYRNSGYFVDCVKQARNYQDLKK-DLVIFAGACQSYYEGLILA 211 Clostridium s...
CDD26896       132 RQASIVVPLLKKYNPDILIVTGHDAMLKKGTNYNNIYNYRNSRHFINTVKEARRWGSSSD-KLVIFAGACQSFYEAIIAS 210 Clostridium s...
CDA59481       129 KQPQMIWGLLGKYNPDILVVTGHDGMIKKGYNFNDIYNYRNSKYFVETVIRARMWEQGAN-KLAIFAGACQSYYEAIMEA 207 Clostridium s...
jgi:Ccel_0237  131 RQPSVVKQYLKSYRPDILVLTGHDGLKKGASNFQSLDSYANSAYFIEAVRIARSYESDPD-KLCIFAGACQSYFEAIMQA 209 Ruminiclostri...
WP_003513147   132 EQPNIIKRALAETKPDILVVTGHDSLKKGS-DPNLLDSYRNSKYFIECVKEARKYQPDYD-KLCIFAGACQSYFEAIMQA 209 Hungateiclost...
jgi:Desru_0149 238 GSNFASSPKRVLIHAFDPVFVVEKIAYTSIHDPIAIREIISSTITGFDGIGGLETRGKHRLGVP 301 Desulfotomaculum ruminis DSM ...
CDC07032       221 GANFASSPARILIDFLDPLVVAEKIALTEKYKYITIDDIAYELRDGRDGIGGIGANGKMTKC-- 282 Clostridium sp. CAG:343
CDE14619       216 GANFASSPARILIDFLDPLIIAEKIATTERYKFITIDDVTNELRDGKKGVGGIGSNGRMVLV-- 277 Clostridium sp. CAG:470
CDE24751       221 GANFASSPARILIDFLDPLIVAEKVAITDEYKYISIDDIYRELRDGKKGVDGIGANGKMKKIPL 284 Clostridium sp. CAG:440
CDA16956       210 GANFASSPGRILIDFMDPLIVAEKIATTDESKYVTISDIERNLRDGIKGVNGIGAMGKKKIVTK 273 Clostridium sp. CAG:571
CDD15977       212 GANFASSPARILIDFIDPLIVAERVAITDEKKFLTINDIEGELRDGKRGISGIGANGKKKIMLM 275 Clostridium sp. CAG:798
CDD26896       211 GADFASSPGRILIDFVDPLIVAEKIAIADECRFVTSNEISREIKEGVKGVSGVGARGKKKIIG- 273 Clostridium sp. CAG:452
CDA59481       208 GANFASSPARILIDFKDPLVVAGKIATTDFNKYVTINDIKNDLRDGENGVSGIGAHGKKRTI-- 269 Clostridium sp. CAG:245
jgi:Ccel_0237  210 GANFASSPRRILINALDPAIVAQKVSVTDSSVILSPNSVIELTITGSAGIGGKDTRGQMR---- 269 Ruminiclostridium cellulolyti...
WP_003513147   210 GANFASSPGRININALDPAIVSEKVALTNKDNYVTPEEVSKLTISGSKGIGGIKTRGHLTVL-- 271 Hungateiclostridium thermocellum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap