Conserved Protein Domain Family
Calsarcin

?
pfam05556: Calsarcin 
Calcineurin-binding protein (Calsarcin)
This family consists of several mammalian calcineurin-binding proteins. The calcium- and calmodulin-dependent protein phosphatase calcineurin has been implicated in the transduction of signals that control the hypertrophy of cardiac muscle and slow fibre gene expression in skeletal muscle. Calsarcin-1 and calsarcin-2 are expressed in developing cardiac and skeletal muscle during embryogenesis, but calsarcin-1 is expressed specifically in adult cardiac and slow-twitch skeletal muscle, whereas calsarcin-2 is restricted to fast skeletal muscle. Calsarcins represent a novel family of sarcomeric proteins that link calcineurin with the contractile apparatus, thereby potentially coupling muscle activity to calcineurin activation. Calsarcin-3, is expressed specifically in skeletal muscle and is enriched in fast-twitch muscle fibers. Like calsarcin-1 and calsarcin-2, calsarcin-3 interacts with calcineurin, and the Z-disc proteins alpha-actinin, gamma-filamin, and telethonin.
Statistics
?
PSSM-Id: 398929
Aligned: 29 rows
Threshold Bit Score: 243.417
Threshold Setting Gi: 47219587
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6P0T8          5 GTPAPPNKRKKPSKIITDLSHiaqdeyesePEASEFDLGKKIRAPKDIMLEELSLNKNKGSKMFKMRQIRVEKFIYEN-- 82  zebrafish
10_pfamImport   3 CTMPAGERKKRAAAICREVHG---------SNGDLMDLGKKLSIPKDIMLEELSLLSNRGSRLFKMRQRRSEKYTFESiq 73 
Q6P2T2          5 SLMSTQERKMQAAAICREIHA---------NEEAEMDLGKKVSAPKEIMLEELSLASNRGSRLFKMRQKRSEKYTFESiq 75  zebrafish
XP_005468260    5 STMTTRERKMQAAAICREVQA---------QEDIEMDLGKKMSVPKDIMLEELSFASNRGSRLFKMRQRRSEKYTFESiq 75  Nile tilapia
5_pfamImport    5 STMTTRERQMQAAAICREVQA---------QEDVEMDLGKKINVPKDIMLEELSLASNRGSRLFKMRQRRSEKYTFESih 75 
XP_005555857    5 NAMV-KQRKQQATAIMKEVHG---------NDVDSMDLGKKVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENfq 74  crab-eating ma...
XP_005044664    5 SALA-KERKEQASAIMDEIHR---------NVSPSLNLGKKVSTPRDIMVEELSTLSNRGARLFKRRQRRSDKYTYENyh 74  Collared flyca...
XP_003221856    5 ADMV-KERKQQASAIMKEIQR---------NESPGMDLGKKVSIPRDIMLEELSLLSNRGARLFKMRQRRSDKYTYENlh 74  green anole
CAG02293        1 --mTTKERKMQAALICREIQL---------HEDAEMDLGIKVSVPKDIMLEELSSTTNRGSRLFKMRQKRAEKYTFESnr 69  spotted green ...
XP_029707246    5 CTMPAGERKKRAAAICREVHG---------SNGDLMDLGKKLSIPKDIMLEELSLLSNRGSRLFKMRQRRSEKYTFENiq 75  torafugu
Q6P0T8         83 --------------------------------------NPDLFSSESMDNLQKFVP-SLGGQMmdvggrliggqmaghag 123 zebrafish
10_pfamImport  74 neantqlssllcss--------qndvlnentvtveikvDPPADD--PPANTNSAAA-SGKNLLk---------------- 126
Q6P2T2         76 nevnvqhstdavfpgpc----------aemtnilsdenclgvdqapNPLNPDNIAP-GYGGPLk---------------- 128 zebrafish
XP_005468260   76 nqnntqlnstaifqtetgnttdshsgqnnvgvdqppkvTCDTTTMEMVPDPTSIAP-GYGGPLk---------------- 138 Nile tilapia
5_pfamImport   76 nennkqlnsliviqpenlsatdnhsgqnnmdvdqppavPSDTPDTSMEPNPDSIAP-GYGGPLk---------------- 138
XP_005555857   75 yesraqinhsiamqng-----kvdgsnleggsqqapltPPNTPDPRSPPNPENIAP-GYSGPLk---------------- 132 crab-eating ma...
XP_005044664   75 yvankprnrgepiqsv-----tmdglsvegmpqhapmtPPNTPDPRSPPHPDNIAP-GYSGPLk---------------- 132 Collared flyca...
XP_003221856   75 fltskprnrseiiqcv-----qldtsgmgadqqhppvtPPNTPDPRSPPNPETIAP-GYSGPLk---------------- 132 green anole
CAG02293       70 nennthpnattefqvndgnsaddhdstnqsadhqpsqvQPKTPDLTKVSSPESIAPgTYGVPLk---------------- 133 spotted green ...
XP_029707246   76 n-----------------------------------eaNMQLS--NDLLNVNAVTV-EIK-------------------- 97  torafugu
Q6P0T8        124 gvgqaPVPPPKPGsfgkgAGGgllagglaggpggvggvgvsgggvggkdglsvdislTGDQSSKAALDKaKKSAEYVKTY 203 zebrafish
10_pfamImport 127 -----AAAAVQLD-----------------------------------------------------------ASSVPRSY 142
Q6P2T2        129 -----DVPAEKFN-----------------------------------------------------------CTAMPKSY 144 zebrafish
XP_005468260  139 -----DIPPEKFN-----------------------------------------------------------STAVPKSY 154 Nile tilapia
5_pfamImport  139 -----DIPPEKFN-----------------------------------------------------------STAVPKSY 154
XP_005555857  133 -----EIPPEKFN-----------------------------------------------------------TTAVPKYY 148 crab-eating ma...
XP_005044664  133 -----EIPPEKFN-----------------------------------------------------------TTAVPKYY 148 Collared flyca...
XP_003221856  133 -----TIPPEKFN-----------------------------------------------------------TTSVPKYY 148 green anole
CAG02293      134 -----DVPPQKFN-----------------------------------------------------------STAVPKSY 149 spotted green ...
XP_029707246   98 -----VDPPAEDD-----AAN------------------------------------ADNAAVSVPAVQ-SNTSTMPRSY 130 torafugu
Q6P0T8        204 ISPWERAMKGNEDLLATMKAQMPSPCTFMELRKYKSFNRSAMPFGGFEKASQLMTFQL-PDIEVA-TEEPEPAVVYQHDI 281 zebrafish
10_pfamImport 143 HSPWEQEILSDPSLAETIKLRMPGPDPRPNLPEYKSFNRVATPFGGFKAITSQASRRLgPGTNPS----PSFPELQ-APG 217
Q6P2T2        145 QSPWEQALTSDPALAQTLLARVPEPESKQQIPQYKSFNRVAIPFGGFGKAPK-VPVKA-VDSDp-eLVVPRPAAEV-PAI 220 zebrafish
XP_005468260  155 HSPWEQAIINDPALADTLITRMPELAPRHDLPGYKSFNRVATPFGGFSKAPRPAPVKT-LQVEIL----PELPELQGDAP 229 Nile tilapia
5_pfamImport  155 HSPWEQAIVSDPALADTLIPNMAEPEPRADLPGYKSFNRVATPFGGFGKAPRPAPTKS-LLQEPL----PNYPELQGDTA 229
XP_005555857  149 QSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASKIVKFKV-PDFELLlLTDPRFMSFV-NPL 226 crab-eating ma...
XP_005044664  149 QSPWIEAIRDDPELLEALYPKLFTPEAKPELPDYRSFNRVATPFGGFERASKLVKFKV-PDYNMLmLNDPRFMILA-NPL 226 Collared flyca...
XP_003221856  149 RSPWIEAISNDPELLEALYPKLFKPEARPELPDFKSFNRVATPFGGFERASKLVKFKV-PDFNFLlLNDPRFMVLA-NPL 226 green anole
CAG02293      150 QSPWEKVSGVDLVFIEPGVPCAPSP-PRSDQPAYKSFNRVAVPFGGFSHAHRPHPVKA-PRLEPL----PDHPEIQAgrg 223 spotted green ...
XP_029707246  131 HSPWEQEILGDPNLAETIKQRMPAPDPLPNLPEYKSFNRVATPFGGFDKAPRTITFKL-PELDLN-P--PNFPELQ-APG 205 torafugu
Q6P0T8        282 NSRPSFNRTPIGWGGSAEP---GSIHMELET------IPfdgETDDL 319 zebrafish
10_pfamImport 218 MKRPSFNRTAQGWITEGTHmivPTITLESVQ------VP---ESDDL 255
Q6P2T2        221 VKRPTFNRTASGWVTDSAPltfPSIPLEPISsmsstfIP---ESDDL 264 zebrafish
XP_005468260  230 VIRPSFNRSALGWVSTGGPvplLNVSIENAL------IP---ESEDL 267 Nile tilapia
5_pfamImport  230 VDRPSFNRSALGWVSNGGPiplTVVSLDPIL------VP---ESDDL 267
XP_005555857  227 SGRRSFNRTPKGWISENIPiviTTEPTDDTT------IP---ESEDL 264 crab-eating macaque
XP_005044664  227 AARRSFNRTPKGWTSENIPv-vFIQPAESNT------VP---ETEDL 263 Collared flycatcher
XP_003221856  227 CTRRSFNRTPKGWTSENIPimiTIQPSEVNG------VP---ETDDL 264 green anole
CAG02293      224 aevvspgaqncppnqgqgpgertpahpvavphryqmawvkffrrprg 270 spotted green pufferfish
XP_029707246  206 IKRPSFNRTAQGWITEGTHmiiPTIPLESIE------VP---ESDDL 243 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap