Conserved Protein Domain Family
Novirhabdo_Nv

?
pfam05554: Novirhabdo_Nv 
Viral hemorrhagic septicemia virus non-virion protein
This family consists of several viral hemorrhagic septicemia virus non-virion (Nv) proteins. The NV protein is a nonstructural protein absent from mature virions although it is present in infected cells. The function of this protein is unknown.
Statistics
?
PSSM-Id: 147629
View PSSM: pfam05554
Aligned: 3 rows
Threshold Bit Score: 213.728
Threshold Setting Gi: 123809404
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1AES6   1 MATQPALSTTSFSPLVLREMITHRLKFDPSNYLNCDLDRSDISPVDFFETTLPRILDDLRASTRLPHLHVLDMRISLLER 80  Viral hemorrhagic sep...
Q1AEQ5   1 MTTKSEHSAISSSPLVLREMITHRLTFDPSNYLNCDFNRSDISTTNFLETTLPRILGDLRASTRLPYLHVLDMRISLLER 80  Viral hemorrhagic sep...
Q1AES1   1 MTTQSAHSTTSFSPLVLREMIAYRLTFDPSNYLNSDLDRSEISATDFFETTLSRVLKDLRTSTRLPYLHVLDMRISLLEG 80  Viral hemorrhagic sep...
Q1AES6  81 THYMFRNVPSSPATTGRLTDPELVIISHAEVGLLTRGSGLTS 122 Viral hemorrhagic septicemia virus
Q1AEQ5  81 THYMFRNIPSSPAITGRRSDPELIIISHAEMMILTSGSESTS 122 Viral hemorrhagic septicemia virus
Q1AES1  81 THYILRNVSSSPATTGRPSDPGLFIISLEGMKTLTNGSESPP 122 Viral hemorrhagic septicemia virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap