4YU6


Conserved Protein Domain Family
Peptidase_M6

?
pfam05547: Peptidase_M6 
Immune inhibitor A peptidase M6
The insect pathogenic Gram-positive Bacillus thuringiensis secretes immune inhibitor A, a metallopeptidase, which specifically cleaves host antibacterial proteins. A homolog of immune inhibitor A, PrtV, has been identified in the Gram-negative human pathogen Vibrio cholerae.
Statistics
?
PSSM-Id: 398926
Aligned: 5 rows
Threshold Bit Score: 948.125
Threshold Setting Gi: 81552779
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4YU6_A 103 AKQAPYKGSVRTDKVLVLLVEFSDYK-----------HNNIDQTPG-----YMYSNDFSREHYQKMLFGNepytlfdGSK 166
Q9S2G1 100 DAKYVELGREKTDKIFTILVEFGDKVdsryggdagplHNEIAKPNRrtdnsTAWQEDYDQEHFQDLYFGS-------GKG 172 Streptomyces coelicolor
Q81HW5 152 AKQAPYKGSVRSDKVLVLLVEFSDYK-----------HNNIDQTPG-----YMYSKDFSREHYQKMLFGNepytlfdGSK 215 Bacillus cereus ATCC ...
Q9KMU6 103 rVFALDVGQKRTDKVLALLIDFPDLPw---------dDNRLTKEHT-----EMLYDRYEPSHYQDLLFSDkgytgpnGEN 168 Vibrio cholerae O1 bi...
Q97L20 130 GPQTSWDGTVTKDKALVILIEFPDLP-----------HNTLTPQDT-----DMYYKDYTTSHYQDMIFGPngysgphNEN 193 Clostridium acetobuty...
4YU6_A 167 VKTFKQYYEEQSGGSYTTDGYVTEWLTVPGKASDYGADg-SsGHDNkGPKgARDLVKEALh-------AAAEKGLDLSQF 238
Q9S2G1 173 VNSVKTYYEKQSSGRYSVDGEVSDWVKVPYNEARYGSNk-C-DPDNcAWYaVQDGVTAWIadqkaagrTDAQIKSQLTQY 250 Streptomyces coelicolor
Q81HW5 216 VKTFKQYYEEQSGGSYTTDGYVTEWLTVPGKASDYGADgsS-GHDNkGPKgARDLVKEALy-------AAAEKGLDLSQF 287 Bacillus cereus ATCC ...
Q9KMU6 169 FISMRQYYESESGNSYSVSGQAAGWYRASKNAAYYGGNs-P-GTNN--DMnARELVREALd------qLARDPNINLADY 238 Vibrio cholerae O1 bi...
Q97L20 194 LVSLKEYYNQQSGGSYDIGGTVVGWYKAQHPAAYYGKN--Q-GSDN-SPR-ARDLVKEAL--------TEVAKHIDLKQF 260 Clostridium acetobuty...
4YU6_A 239 DQFDRYDTNSDGNQNEPDGVIDHLMVIHAGVGQEAGGGKLGDDAIWSHRSKLAiDpvAIEGTKSKVD----YFGGKVAAH 314
Q9S2G1 251 DQWDRYDFDGDGDFNEPDGYIDHFQIVHAGEDESAGGGAQGEDAIWAHRWYAFgTdaGATGPADNKLggtqIGDTGIWVG 330 Streptomyces coelicolor
Q81HW5 288 DQFDRYDTNGDGNQNEPDGVIDHLMVIHAGVGQEAGGGKLGDDAIWSHRSKLAvDpvAIEGTKSKVD----YFGGKVAAH 363 Bacillus cereus ATCC ...
Q9KMU6 239 DIEDRYDYNGNGNFREPDGVIDHLMIFHASVGEEAGGGVLGADAIWSHRFNLG-RyhVLEGTKSNVPg---RFNGQFAAF 314 Vibrio cholerae O1 bi...
Q97L20 261 DVKDPYDLNGDGNLNEPDGIIDHLMIIHSGMGEEAGGGSIGTDAIWSHSSKVY-D--MDNGTTKPWK----IPGTDMSAY 333 Clostridium acetobuty...
4YU6_A 315 DYTIEPEDGAVGVFAHAFGHDLGLPDEYDTkyTGTGSPVEAWSLMSGGSWTGKIAgTEPTSFSPQNKDFLQKNMGgnWAK 394
Q9S2G1 331 DYTIQPENGGLGVYAHEYGHDLGLPDHYDT--AGGDNSTGFWTLMSSGSWLGTGR-NEIGDLPGDMNAWDKLQLG--WLN 405 Streptomyces coelicolor
Q81HW5 364 DYTIEPEDGAVGVFAHEFGHDLGLPDEYDTkyTGNGSPVEAWSLMSGGSWTGKIAgTEPTSFSPQNKDFLQKNMGgnWAK 443 Bacillus cereus ATCC ...
Q9KMU6 315 DYTIQPIDAAAGVCAHEYGHDLGLPDEYDTqyTGTGEPVSYWSIMSSGSWAGKIGgTQPTAFSSWAKQFLQNSIGgrWIN 394 Vibrio cholerae O1 bi...
Q97L20 334 PYTIMPEDGAAGVFCHEFGHDLGLPDEYDTqySGKGEPVGYWSIMSSGSWSGTIPgTEPSGFSAYDKEYFQKRYGgnWFH 413 Clostridium acetobuty...
4YU6_A 395 ileVDYDKIKRgVGVPTYIDQSVTKSNRPGVVRVNLPGKSVETIKPEFGKHAYYSTRGDDMHTTLET-PfFDLTKGTNAK 473
Q9S2G1 406 ---YDTAKAGVnSWHKLGLAEYNTKHKQGLVVELPKEKVTTEIVTPAEGETQWWSGSGNDLKNTLSR-S-VDLTGKSAAS 480 Streptomyces coelicolor
Q81HW5 444 ileVDYDKIKSgVGVPTYIDQSVTKSNRPGVVRVNLPGKSVETIKPEFGKHAYYSTRGDDMHTTLETpF-FDLTKGTNAK 522 Bacillus cereus ATCC ...
Q9KMU6 395 heqLSINELEA-KPRVVTLFQTTDNS-RPNMVKVTLPMKRVEGIKPAEGEFSFYSNRGDDLKNRMSR-P-LTIPAGSQAT 470 Vibrio cholerae O1 bi...
Q97L20 414 gntIDLSSLNK-KGKKYTLDAASEKSVNNDFVKVTLPQKSTTITKPSSGSYLYFSGKGDNLNNSMST-A-IDLTNATSAD 490 Clostridium acetobuty...
4YU6_A 474 FDYKANYELEAECDFVEVHa--VTEDGTKTLIDRLGEKVVQGDKDTTDGK---------WIDKSYDLSQFKGKKVKLQFD 542
Q9S2G1 481 LTLDGWYDIEADYDFLYTE---VSTDGGANWTAIDGTFDGNPIQRDGSDKpalsatvdaYGKLVYPLDAYAGKKIDLRFR 557 Streptomyces coelicolor
Q81HW5 523 FDYKANYELEAECDFVEVHa--VTEDGTKTLIDRLGEKVVQGDKDTTDg---------kWIDKSYDLSQFKGKKVKLQFD 591 Bacillus cereus ATCC ...
Q9KMU6 471 LRFKAWFQIEKDYDYARVLingKPIAGNITTMDDPFKSGLVPAISGQSd---------gWVDAQFDLSAWAGQTVELAFD 541 Vibrio cholerae O1 bi...
Q97L20 491 FNFKTWYNIEQDWDYASVQ---VQVDGANTWTSIPGNITTSTNPNNQNPGngitgksngWIDAKFDLKDYIGKKINLKLN 567 Clostridium acetobuty...
4YU6_A 543 YITDPAVTYKGFAMDHVNVTVDGQVVFSDDAEG-QSKMNLNGFVVSDG--TEKKAHYYYLEWRNYAGSDNGL-------- 611
Q9S2G1 558 YQTDGGLAMKGFTADEIAVTADGETLFSDNAETaDDAWTAVGFTRKGAsfTKEYAQYYIAENRQYVSYDKTLktgpynfg 637 Streptomyces coelicolor
Q81HW5 592 YITDPAVTYKGFAMDNVNVTVDGQVVFSDDAEG-QSKMNLNGFVVSDG--TEKKAHYYYLEWRNYAGSDNGL-------- 660 Bacillus cereus ATCC ...
Q9KMU6 542 YLTDGGLAMEGLYVDDLRLEVDGNQTLIDNAEG-TSSFAFQGFTKNGG--FHEANHYYLLQWRSHNDVDQGLan------ 612 Vibrio cholerae O1 bi...
Q97L20 568 YWTDAGGDMDGFYVDDLALNINGKQAFIDDAEGaTSRFTLNGFTKDSG--IKLTDQYYLMELRNHYGTDSGLgh------ 639 Clostridium acetobuty...
4YU6_A 612 -----KAGKGPVYNTGLVVWYADDSFKDNWVGVHPGEGFLGVVDSHPEAFVgNLNGKPTYGntGMQIADAAFSFDQTPAW 686
Q9S2G1 638 fserpNWVEHYAYQNGLLIWKWDTSQADNNTSQHPGKGLVLPIDSHPTALK-WKDGTVMRN--RMQAYDSPFSLYRTDGM 714 Streptomyces coelicolor
Q81HW5 661 -----KAGKGPVYNTGLVVWYADDSFKDNWVGVHPGEGFLGVVDSHPEALVgNLNGKPAYGntGMQIADAAFSFDKTPAW 735 Bacillus cereus ATCC ...
Q9KMU6 613 ---lkRFGQLMSFEPGLLVWYVDESYADNWVGKHPGEGWLGVVDADQNALVwSKTGEVAQT--RFQVRDATFSLFDQAPL 687 Vibrio cholerae O1 bi...
Q97L20 640 ---ikRGASLMSYDPGVVVWYVDNLYSDNWTGIHPGHGFLSVVDADQHLLR-WSDGTLADN--KYELHDAAFTTRKARKM 713 Clostridium acetobuty...
4YU6_A 687 SVNS---LTRGQFNYSGLQGVTTFDDSKVYSNNQIADAGRKVPKLGLKFQVVGQADDKSAGAV 746
Q9S2G1 715 TLHK---ADVAKYVPGSKGVSVFNDRKNDYYDPANPTGGVKITDTNTKIKILKEAKNGSTIEL 774 Streptomyces coelicolor
Q81HW5 736 SVNS---LTRGQFNYSGLQGVTTFDDSKVYSNKQIADAGRKVPNLGLKFQVVGQAEDKSAGAV 795 Bacillus cereus ATCC 14579
Q9KMU6 688 KLVT---ADGNTLEDMNLTANASFSDDQDYSSPQAPDSGRKVMPFGLKIDLLSQSKENEYGVV 747 Vibrio cholerae O1 biovar El Tor str. ...
Q97L20 714 FIDYsntSTPKTLTDDVISKHPTFEDDRPYITEELPDVGVILPHFGLKMNVIDQANDGSHANI 776 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap