Conserved Protein Domain Family
She9_MDM33

?
pfam05546: She9_MDM33 
She9 / Mdm33 family
Members of this family are mitochondrial inner membrane proteins with a role in inner mitochondrial membrane organisation and biogenesis.
Statistics
?
PSSM-Id: 398925
Aligned: 54 rows
Threshold Bit Score: 265.594
Threshold Setting Gi: 406701424
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EKD04570             209 LDKKSRELAQQADKNFSLLGLRVNEVTGYREVELLKEAVKSRgasltadvaltpEREIEGKRKNVREAKVAYETAVATLS 288 Trichos...
LoveMIT:GQ68_03975T0  44 LSEKLNTMYTDLNSSISITSRIVNEITGYNRIETLKKEILAN------------EIKLNELKSNITEAKTRYQDAINNRN 111 Komagat...
P0CR46               161 VLEHSRYVIQEAQKKFVGLGLKVNEMTGYQEVERLKYMVFEK------------EDELQRLREHARTAKAAYDEAVAARS 228 Cryptoc...
XP_011390655         208 ISLHTRTLLTQLRTKLSHLSSQYNMHTGYTAIEELKHRIGTL------------ETSLEAARTLASTAKKTYLMAVQERS 275 Ustilag...
XP_016294043          69 aTAHTHTLLARLRTKLTHLSTQYNTHTGYAAIEGLKTRIDEL------------ESSLSSARSLASTAKRTYLIAVQSRS 136 Kalmano...
EPT05178              46 fRQRIDQYTANLARSFSQLGKEINKLTGYGEIEELKRIVVTQ------------EARIEAVRRAAREAKEAYDAAVRLRA 113 Fomitop...
EGN98027              84 vRRRTDEVTSRTSVTFSRLGSQLNHVTGYEEIEALKR-----------------QAKIKATRQASREAKTAYDDAAAQRS 146 Serpula...
EKM79340             137 frdRADELTNHTKTRFSQLGGELSKATGYEEIEVLKKEVVEQ------------EERIKATRQAAKQAKLAYEQSVIRRS 204 Agaricu...
XP_007855683          99 frQKADDFTGSTKVTFSQLGSQLNKVTGYDEIEALKRQVVEQ------------EARIKEARRAARQAKLQYQQAVFQRS 166 Monilio...
XP_009649550         194 ltttIPRLIDTLQVRLLTASQTLNDLTGYTSIERIKTQNEAL------------ETSLAAAHQRLRATRQSYKNATGDRA 261 Vertici...
EKD04570             289 KTQQDVQALLERKHTWSDHDVAHFTQLVRSDHASKNAVETTSQQLKEAELAVDTAFTALMQSILERYHEEQVWSDKIRSV 368 Trichos...
LoveMIT:GQ68_03975T0 112 NSQVEINKLLQRKNDWNLQELEQFTNLYKNDHNLQTKENETKLKLQELESKEDEYHNNLINSILNRYHEEQIWSDKIRKL 191 Komagat...
P0CR46               229 EAQRETNILLERKHSWTDADVSKFTSLVRSDHTSSHAVASTSIALKDAEIAVDKSFSQLMQVILQRYHEEQVWSDKIRSV 308 Cryptoc...
XP_011390655         276 ASQRETNDLLSRKNSWSETDLSRYTELLRKEHALSRHESEAEKELERSEAEVQASFDQLMKAVLVRYHEEQVWSDRMRGM 355 Ustilag...
XP_016294043         137 ASQRETNDLLSRKSSWSESDLGRYTELLRKEHALSREEAEAEKVLEKSEAQVQASFDELMKAVMVRYHEEQIWSDRMRGM 216 Kalmano...
EPT05178             114 TSQREVNDLLQRKSTWSDQDVIRFTELVRKDHLHEQEETRAKLAASGAEDAVEREFSELMRVILNRYHEEQAWSDKIRSA 193 Fomitop...
EGN98027             147 VSQREVNDLLQRKSNWSDGDVSRFTSLVRQDHLYEQDEARAKARVEETEDAVEREFSELMRSILARYHEEQVWSDKIRSA 226 Serpula...
EKM79340             205 ESQREVNELLQRKSYWNDADLARFTDIVRQDHSHEQEESRAKAAVDETESAVEREFTQLLKSILARYHEEQVWSDKIRSM 284 Agaricu...
XP_007855683         167 NSQRELNDLLQRKSSWTDHDVSRFTTLVREDHTFVQEEARSKAAVDETEEAVEKEFNELTRSILTRYHEEQVWSDKIRSA 246 Monilio...
XP_009649550         262 ATQRETTTLLARKESWVPQDLERFTELYRRDHTLEHEVGRASEALAEAEAEEQRLSQALMAGMLRRYHEEQIWSDRIRRA 341 Vertici...
EKD04570             369 STWASLVVLGANLIVFVGAIAFVEPWKRKRLVEGLEERMTGMMTKVDSQ 417 Trichosporon asahii var. asahii CBS 8904
LoveMIT:GQ68_03975T0 192 STWGTVTIMAVNLLMLVIVQLLLEPWKRRRMLQKFSDSVNEQLATLKEE 240 Komagataella phaffii GS115
P0CR46               309 STWANVAGLAINFIIFVGAVLLVEPWKRKRLVEKLEERVASMMERVDHR 357 Cryptococcus neoformans var. neoforman...
XP_011390655         356 STYASLVVAGLNAFLFILAILLVEPYKRKKLAETFEKRLVAAEHESrrl 404 Ustilago maydis 521
XP_016294043         217 STYGSLVVAGLNAVLFVVAILLVEPYKRRRLAETFETRLVSAEEQSRel 265 Kalmanozyma brasiliensis GHG001
EPT05178             194 STYGSLAVMGANLLVFVVAILFVEPWKRRRLAQTFERKVEEMSAENAAR 242 Fomitopsis pinicola FP-58527 SS1
EGN98027             227 STYGSLAVLGLNLAVFLLAIAVVEPWKRRRLAQTFEKKIEEMNEENATM 275 Serpula lacrymans var. lacrymans S7.3
EKM79340             285 STYGSLAALGLNLLVFILAILIVEPWKRRRLAQTFETKIEELSVENAMK 333 Agaricus bisporus var. burnettii JB137-S8
XP_007855683         247 STYGQLAALGLNLLVFILAIVAVEPWKRRRLAQTFEKKIEEMEVEYKTA 295 Moniliophthora roreri MCA 2997
XP_009649550         342 STWGTWGLMGVNVLLFIVLQLFAEPWRRRRLVRAVVAEEKSVLESVRDE 390 Verticillium dahliae VdLs.17
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap